Ephrin B2 (EFNB2) (NM_004093) Human Mass Spec Standard
CAT#: PH320133
EFNB2 MS Standard C13 and N15-labeled recombinant protein (NP_004084)
View other "Ephrin B2" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | EFNB2 MS Standard C13 and N15-labeled recombinant protein (NP_004084) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220133 |
Predicted MW | 36.7 kDa |
Protein Sequence |
>RC220133 representing NM_004093
Red=Cloning site Green=Tags(s) MAVRRDSVWKYCWGVLMVLCRTAISKSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTV GQYEYYKVYMVDKDQADRCTIKKENTPLLNCAKPDQDIKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNG SLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSTRNKDPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDG NSAGHSGNNILGSEVALFAGIASGCIIFIVIIITLVVLLLKYRRRHRKHSPQHTTTLSLSTLATPKRSGN NNGSEPSDIIIPLRTADSVFCPHYEKVSGDYGHPVYIVQEMPPQSPANIYYKV myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_004084 |
RefSeq Size | 4335 |
RefSeq ORF | 999 |
Synonyms | EPLG5; Htk-L; HTKL; LERK5 |
Locus ID | 1948 |
Cytogenetics | 13q33.3 |
Summary | This gene encodes a member of the ephrin (EPH) family. The ephrins and EPH-related receptors comprise the largest subfamily of receptor protein-tyrosine kinases and have been implicated in mediating developmental events, especially in the nervous system and in erythropoiesis. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. This gene encodes an EFNB class ephrin which binds to the EPHB4 and EPHA3 receptors. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Axon guidance |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC418220 | EFNB2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY418220 | Transient overexpression lysate of ephrin-B2 (EFNB2) |
CNY 3,080.00 |
|
TP320133 | Recombinant protein of human ephrin-B2 (EFNB2), 20 µg |
CNY 2,900.00 |
|
TP720391 | Recombinant protein of human ephrin-B2 (EFNB2) |
CNY 3,140.00 |
其它Ephrin B2产品