WWOX (NM_016373) Human Mass Spec Standard
CAT#: PH320747
WWOX MS Standard C13 and N15-labeled recombinant protein (NP_057457)
View other "WWOX" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | WWOX MS Standard C13 and N15-labeled recombinant protein (NP_057457) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220747 |
Predicted MW | 46.5 kDa |
Protein Sequence |
>RC220747 representing NM_016373
Red=Cloning site Green=Tags(s) MAALRYAGLDDTDSEDELPPGWEERTTKDGWVYYANHTEEKTQWEHPKTGKRKRVAGDLPYGWEQETDEN GQVFFVDHINKRTTYLDPRLAFTVDDNPTKPTTRQRYDGSTTAMEILQGRDFTGKVVVVTGANSGIGFET AKSFALHGAHVILACRNMARASEAVSRILEEWHKAKVEAMTLDLALLRSVQHFAEAFKAKNVPLHVLVCN AATFALPWSLTKDGLETTFQVNHLGHFYLVQLLQDVLCRSAPARVIVVSSESHRFTDINDSLGKLDFSRL SPTKNDYWAMLAYNRSKLCNILFSNELHRRLSPRGVTSNAVHPGNMMYSNIHRSWWVYTLLFTLARPFTK SMQQGAATTVYCAAVPELEGLGGMYFNNCCRCMPSPEAQSEETARTLWALSERLIQERLGSQSG myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_057457 |
RefSeq Size | 2264 |
RefSeq ORF | 1242 |
Synonyms | D16S432E; DEE28; EIEE28; FOR; FRA16D; HHCMA56; PRO0128; SCAR12; SDR41C1; WOX1 |
Locus ID | 51741 |
Cytogenetics | 16q23.1-q23.2 |
Summary | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) protein family. This gene spans the FRA16D common chromosomal fragile site and appears to function as a tumor suppressor gene. Expression of the encoded protein is able to induce apoptosis, while defects in this gene are associated with multiple types of cancer. Disruption of this gene is also associated with autosomal recessive spinocerebellar ataxia 12. Disruption of a similar gene in mouse results in impaired steroidogenesis, additionally suggesting a metabolic function for the protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2014] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC413978 | WWOX HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY413978 | Transient overexpression lysate of WW domain containing oxidoreductase (WWOX), transcript variant 1 |
CNY 3,080.00 |
|
TP320747 | Recombinant protein of human WW domain containing oxidoreductase (WWOX), transcript variant 1, 20 µg |
CNY 2,900.00 |