United States
Germany
Japan
United Kingdom
China
DHRS9 (NM_199204) Human Mass Spec Standard
CAT＃: PH320853
DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_954674)
View other "DHRS9" proteins (15)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
热销推荐Specifications
| Product Data | |
| Description | DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_954674) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC220853 |
| Predicted MW | 35.2 kDa |
| Protein Sequence |
>RC220853 protein sequence
Red=Cloning site Green=Tags(s) MLFWVLGLLILCGFLWTRKGKLKIEDITDKYIFITGCDSGFGNLAARTFDKKGFHVIAACLTESGSTALK AETSERLRTVLLDVTDPENVKRTAQWVKNQVGEKGLWGLINNAGVPGVLAPTDWLTLEDYREPIEVNLFG LISVTLNMLPLVKKAQGRVINVSSVGGRLAIVGGGYTPSKYAVEGFNDSLRRDMKAFGVHVSCIEPGLFK TNLADPVKVIEKKLAIWEQLSPDIKQQYGEGYIEKSLDKLKGNKSYVNMDLSPVVECMDHALTSLFPKTH YAAGKDAKIFWIPLSHMPAALQDFLLLKQKAELANPKAV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_954674 |
| RefSeq Size | 1993 |
| RefSeq ORF | 957 |
| Synonyms | 3-alpha-HSD; 3ALPHA-HSD; RDH-E2; RDH-TBE; RDH15; RDHL; RDHTBE; RETSDR8; SDR9C4 |
| Locus ID | 10170 |
| Cytogenetics | 2q31.1 |
| Summary | This gene encodes a member of the short-chain dehydrogenases/reductases (SDR) family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. This protein demonstrates oxidoreductase activity toward hydroxysteroids and is able to convert 3-alpha-tetrahydroprogesterone to dihydroxyprogesterone and 3-alpha-androstanediol to dihydroxyprogesterone in the cytoplasm, and may additionally function as a transcriptional repressor in the nucleus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014] |
| Protein Families | Druggable Genome |
| Protein Pathways | Metabolic pathways, Retinol metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC404693 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417061 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427994 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427995 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429267 | DHRS9 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY404693 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2 |
CNY 3,080.00 |
|
| LY417061 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 |
CNY 3,080.00 |
|
| LY427994 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3 |
CNY 3,080.00 |
|
| LY427995 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4 |
CNY 3,080.00 |
|
| LY429267 | Transient overexpression lysate of dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 1 |
CNY 3,080.00 |
|
| PH326895 | DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135742) |
CNY 14,250.00 |
|
| PH326904 | DHRS9 MS Standard C13 and N15-labeled recombinant protein (NP_001135743) |
CNY 14,250.00 |
|
| TP320853 | Recombinant protein of human dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326895 | Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP326904 | Purified recombinant protein of Homo sapiens dehydrogenase/reductase (SDR family) member 9 (DHRS9), transcript variant 4, 20 µg |
CNY 2,900.00 |
