SLAMF7 (NM_021181) Human Mass Spec Standard
CAT#: PH320985
SLAMF7 MS Standard C13 and N15-labeled recombinant protein (NP_067004)
View other "SLAMF7" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | SLAMF7 MS Standard C13 and N15-labeled recombinant protein (NP_067004) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC220985 |
Predicted MW | 37.2 kDa |
Protein Sequence |
>RC220985 representing NM_021181
Red=Cloning site Green=Tags(s) MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTI IVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEYVLHVYEHLSKPKVTMGLQSN KNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSILPISWRWGESDMTFICVARNPVSRNFSSPIL ARKLCEGAADDPDSSMVLLCLLLVPLLLSLFVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGE NTEYDTIPHTNRTILKEDPANTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_067004 |
RefSeq Size | 2672 |
RefSeq ORF | 1005 |
Synonyms | 19A; CD319; CRACC; CS1 |
Locus ID | 57823 |
Cytogenetics | 1q23.3 |
Summary | Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and thus are involved in the regulation and interconnection of both innate and adaptive immune response. Activities are controlled by presence or absence of small cytoplasmic adapter proteins, SH2D1A/SAP and/or SH2D1B/EAT-2. Isoform 1 mediates NK cell activation through a SH2D1A-independent extracellular signal-regulated ERK-mediated pathway (PubMed:11698418). Positively regulates NK cell functions by a mechanism dependent on phosphorylated SH2D1B. Downstream signaling implicates PLCG1, PLCG2 and PI3K (PubMed:16339536). In addition to heterotypic NK cells-target cells interactions also homotypic interactions between NK cells may contribute to activation. However, in the absence of SH2D1B, inhibits NK cell function. Acts also inhibitory in T-cells (By similarity). May play a role in lymphocyte adhesion (PubMed:11802771). In LPS-activated monocytes negatively regulates production of proinflammatory cytokines (PubMed:23695528).[UniProtKB/Swiss-Prot Function] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402852 | SLAMF7 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402852 | Transient overexpression lysate of SLAM family member 7 (SLAMF7) |
CNY 3,080.00 |
|
TP320985 | Recombinant protein of human SLAM family member 7 (SLAMF7), 20 µg |
CNY 2,900.00 |
|
TP720631 | Purified recombinant protein of Human SLAM family member 7 (SLAMF7) |
CNY 1,800.00 |
|
TP723925 | Human CS1 Protein, hFc-His Tag |
CNY 5,876.00 |