Nogo A (RTN4) (NM_007008) Human Mass Spec Standard
CAT#: PH321080
RTN4 MS Standard C13 and N15-labeled recombinant protein (NP_008939)
View other "Nogo A" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | RTN4 MS Standard C13 and N15-labeled recombinant protein (NP_008939) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221080 |
Predicted MW | 22.2 kDa |
Protein Sequence |
>RC221080 representing NM_007008
Red=Cloning site Green=Tags(s) MDGQKKNWKDKVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRIYKGVIQA IQKSDEGHPFRAYLESEVAISEELVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAVLMWVFTYVGA LFNGLTLLILALISLFSVPVIYERHQAQIDHYLGLANKNVKDAMAKIQAKIPGLKRKAE myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_008939 |
RefSeq Size | 1808 |
RefSeq ORF | 597 |
Synonyms | ASY; Nbla00271; Nbla10545; NI220/250; NOGO; NSP; NSP-CL; RTN-X; RTN4-A; RTN4-B1; RTN4-B2; RTN4-C |
Locus ID | 57142 |
Cytogenetics | 2p16.1 |
Summary | This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells. The product of this gene is a potent neurite outgrowth inhibitor which may also help block the regeneration of the central nervous system in higher vertebrates. Alternatively spliced transcript variants derived both from differential splicing and differential promoter usage and encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402073 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC403920 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC412411 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC429630 | RTN4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY402073 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 3 |
CNY 3,080.00 |
|
LY403920 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 4 |
CNY 3,080.00 |
|
LY412411 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 1 |
CNY 4,840.00 |
|
LY429630 | Transient overexpression lysate of reticulon 4 (RTN4), transcript variant 1 |
CNY 4,840.00 |
|
PH320981 | RTN4 MS Standard C13 and N15-labeled recombinant protein (NP_997403) |
CNY 19,520.00 |
|
TP320981 | Recombinant protein of human reticulon 4 (RTN4), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
TP321080 | Recombinant protein of human reticulon 4 (RTN4), transcript variant 3, 20 µg |
CNY 2,900.00 |