United States
Germany
Japan
United Kingdom
China
Dystrobrevin alpha (DTNA) (NM_001390) Human Mass Spec Standard
CAT＃: PH321162
DTNA MS Standard C13 and N15-labeled recombinant protein (NP_001381)
View other "Dystrobrevin alpha" proteins (17)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
| Product Data | |
| Description | DTNA MS Standard C13 and N15-labeled recombinant protein (NP_001381) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221162 |
| Predicted MW | 83.9 kDa |
| Protein Sequence |
>RC221162 representing NM_001390
Red=Cloning site Green=Tags(s) MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNL DPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLC GGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFL DTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSH SNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLF SHSVPSSGSPFITRSSPPKDSEVEQNKLLARAAPAFLKGKGIQYSLNVADRLADEHVLIGLYVNMLRNNP SCMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIAELENKNREILQEI QRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGS PRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGVGGDVQEAFAQSSRRNLRNDLLVAADSITNTMSS LVKELNSEVGSETESNVDSEFARTQFEDLVPSPTSEKAFLAQIHARKPGYIHSGATTSTMRGDMVTEDAD PYVQPEDENYENDSVRQLENELQMEEYLKQKLQDEAYQVSLQG myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001381 |
| RefSeq Size | 6358 |
| RefSeq ORF | 2229 |
| Synonyms | D18S892E; DRP3; DTN; DTN-A; LVNC1 |
| Locus ID | 1837 |
| Cytogenetics | 18q12.1 |
| Summary | The protein encoded by this gene belongs to the dystrobrevin subfamily of the dystrophin family. This protein is a component of the dystrophin-associated protein complex (DPC), which consists of dystrophin and several integral and peripheral membrane proteins, including dystroglycans, sarcoglycans, syntrophins and alpha- and beta-dystrobrevin. The DPC localizes to the sarcolemma and its disruption is associated with various forms of muscular dystrophy. Mutations in this gene are associated with left ventricular noncompaction with congenital heart defects. Multiple alternatively spliced transcript variants encoding different isoforms have been identified for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC409817 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC409818 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC409819 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC419965 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434373 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC434375 | DTNA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LY409817 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 5 |
CNY 4,840.00 |
|
| LY409818 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 6 |
CNY 3,080.00 |
|
| LY409819 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 8 |
CNY 3,080.00 |
|
| LY419965 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 7 |
CNY 3,080.00 |
|
| LY434373 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 12 |
CNY 4,840.00 |
|
| LY434375 | Transient overexpression lysate of dystrobrevin, alpha (DTNA), transcript variant 11 |
CNY 4,840.00 |
|
| PH313549 | DTNA MS Standard C13 and N15-labeled recombinant protein (NP_116762) |
CNY 19,520.00 |
|
| PH323952 | DTNA MS Standard C13 and N15-labeled recombinant protein (NP_116761) |
CNY 19,520.00 |
|
| TP313549 | Recombinant protein of human dystrobrevin, alpha (DTNA), transcript variant 6, 20 µg |
CNY 2,900.00 |
|
| TP321162 | Recombinant protein of human dystrobrevin, alpha (DTNA), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP323952 | Recombinant protein of human dystrobrevin, alpha (DTNA), transcript variant 5, 20 µg |
CNY 2,900.00 |
其它Dystrobrevin alpha产品
