CRLF2 (NM_022148) Human Mass Spec Standard
CAT#: PH321190
CRLF2 MS Standard C13 and N15-labeled recombinant protein (NP_071431)
View other "CRLF2" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | CRLF2 MS Standard C13 and N15-labeled recombinant protein (NP_071431) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221190 |
Predicted MW | 41.8 kDa |
Protein Sequence |
>RC221190 representing NM_022148
Red=Cloning site Green=Tags(s) MGRLVLLWGAAVFLLGGWMALGQGGAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQC TNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDL SYGDLLYEVQYRSPFDTEWQSKQENTCNVTIEGLDAEKCYSFWVRVKAMEDVYGPDTYPSDWSEVTCWQR GEIRDACAETPTPPKPKLSKFILISSLAILLMVSLLLLSLWKLWRVRKFLIPSVPDPKSIFPGLFEIHQG NFQEWITDTQNVAHLHKMAGAEQESGPEEPLVVQLAKTEAESPRMLDPQTEEKEASGGSLQLPHQPLQGG DVVTIGGFTFVMNDRSYVAL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_071431 |
RefSeq Size | 1579 |
RefSeq ORF | 1110 |
Synonyms | CRL2; CRLF2Y; TSLPR |
Locus ID | 64109 |
Cytogenetics | X;Y |
Summary | This gene encodes a member of the type I cytokine receptor family. The encoded protein is a receptor for thymic stromal lymphopoietin (TSLP). Together with the interleukin 7 receptor (IL7R), the encoded protein and TSLP activate STAT3, STAT5, and JAK2 pathways, which control processes such as cell proliferation and development of the hematopoietic system. Rearrangement of this gene with immunoglobulin heavy chain gene (IGH) on chromosome 14, or with P2Y purinoceptor 8 gene (P2RY8) on the same X or Y chromosomes is associated with B-progenitor acute lymphoblastic leukemia (ALL) and Down syndrome ALL. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014] |
Protein Families | Druggable Genome, Secreted Protein, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction, Jak-STAT signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC411736 | CRLF2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY411736 | Transient overexpression lysate of cytokine receptor-like factor 2 (CRLF2), transcript variant 1 |
CNY 3,080.00 |
|
TP321190 | Recombinant protein of human cytokine receptor-like factor 2 (CRLF2), transcript variant 1, 20 µg |
CNY 2,900.00 |