HNRPH2 (HNRNPH2) (NM_019597) Human Mass Spec Standard
CAT#: PH321204
HNRNPH2 MS Standard C13 and N15-labeled recombinant protein (NP_062543)
View other "HNRPH2" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | HNRNPH2 MS Standard C13 and N15-labeled recombinant protein (NP_062543) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221204 |
Predicted MW | 49.3 kDa |
Protein Sequence |
>RC221204 protein sequence
Red=Cloning site Green=Tags(s) MMLSTEGREGFVVKVRGLPWSCSADEVMRFFSDCKIQNGTSGIRFIYTREGRPSGEAFVELESEEEVKLA LKKDRETMGHRYVEVFKSNSVEMDWVLKHTGPNSPDTANDGFVRLRGLPFGCSKEEIVQFFSGLEIVPNG MTLPVDFQGRSTGEAFVQFASQEIAEKALKKHKERIGHRYIEIFKSSRAEVRTHYDPPRKLMAMQRPGPY DRPGAGRGYNSIGRGAGFERMRRGAYGGGYGGYDDYGGYNDGYGFGSDRFGRDLNYCFSGMSDHRYGDGG SSFQSTTGHCVHMRGLPYRATENDIYNFFSPLNPMRVHIEIGPDGRVTGEADVEFATHEDAVAAMAKDKA NMQHRYVELFLNSTAGTSGGAYDHSYVELFLNSTAGASGGAYGSQMMGGMGLSNQSSYGGPASQQLSGGY GGGYGGQSSMSGYDQVLQENSSDYQSNLA myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_062543 |
RefSeq Size | 2392 |
RefSeq ORF | 1347 |
Synonyms | FTP3; hnRNPH'; HNRPH'; HNRPH2; MRXSB; NRPH2 |
Locus ID | 3188 |
Cytogenetics | Xq22.1 |
Summary | This gene belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has three repeats of quasi-RRM domains that binds to RNAs. It is very similar to the family member HNRPH1. This gene is thought to be involved in Fabray disease and X-linked agammaglobulinemia phenotype. Alternative splicing results in multiple transcript variants encoding the same protein. Read-through transcription between this locus and the ribosomal protein L36a gene has been observed. [provided by RefSeq, Jan 2011] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412724 | HNRNPH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC422325 | HNRNPH2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY412724 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), transcript variant 1 |
CNY 4,840.00 |
|
LY422325 | Transient overexpression lysate of heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), transcript variant 2 |
CNY 4,840.00 |
|
TP321204 | Recombinant protein of human heterogeneous nuclear ribonucleoprotein H2 (H') (HNRNPH2), transcript variant 1, 20 µg |
CNY 2,900.00 |