United States
Germany
Japan
United Kingdom
China
LIPF (NM_004190) Human Mass Spec Standard
CAT＃: PH321225
LIPF MS Standard C13 and N15-labeled recombinant protein (NP_004181)
View other "LIPF" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | LIPF MS Standard C13 and N15-labeled recombinant protein (NP_004181) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221225 |
| Predicted MW | 45.24 kDa |
| Protein Sequence |
>RC221225 representing NM_004190
Red=Cloning site Green=Tags(s) MWLLLTMASLISVLGTTHGLFGKLHPGSPEVTMNISQMITYWGYPNEEYEVVTEDGYILEVNRIPYGKKN SGNTGQRPVVFLQHGLLASATNWISNLPNNSLAFILADAGYDVWLGNSRGNTWARRNLYYSPDSVEFWAF SFDEMAKYDLPATIDFIVKKTGQKQLHYVGHSQGTTIGFIAFSTNPSLAKRIKTFYALAPVATVKYTKSL INKLRFVPQSLFKFIFGDKIFYPHNFFDQFLATEVCSREMLNLLCSNALFIICGFDSKNFNTSRLDVYLS HNPAGTSVQNMFHWTQAVKSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQD VGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_004181 |
| RefSeq Size | 1365 |
| RefSeq ORF | 1194 |
| Synonyms | GL; HGL; HLAL |
| Locus ID | 8513 |
| Cytogenetics | 10q23.31 |
| Summary | This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2010] |
| Protein Families | Druggable Genome, Secreted Protein |
| Protein Pathways | Glycerolipid metabolism, Metabolic pathways |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401348 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434185 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434194 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC434213 | LIPF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401348 | Transient overexpression lysate of lipase, gastric (LIPF) |
CNY 3,080.00 |
|
| LY434185 | Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 3 |
CNY 3,080.00 |
|
| LY434194 | Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 4 |
CNY 3,080.00 |
|
| LY434213 | Transient overexpression lysate of lipase, gastric (LIPF), transcript variant 1 |
CNY 3,080.00 |
|
| TP321225 | Recombinant protein of human lipase, gastric (LIPF), 20 µg |
CNY 2,900.00 |
|
| TP721035 | Purified recombinant protein of Human lipase, gastric (LIPF), transcript variant 2 |
CNY 1,800.00 |
