United States
Germany
Japan
United Kingdom
China
NDRG4 (NM_022910) Human Mass Spec Standard
CAT＃: PH321301
NDRG4 MS Standard C13 and N15-labeled recombinant protein (NP_075061)
View other "NDRG4" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | NDRG4 MS Standard C13 and N15-labeled recombinant protein (NP_075061) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221301 |
| Predicted MW | 40.6 kDa |
| Protein Sequence |
>RC221301 representing NM_022910
Red=Cloning site Green=Tags(s) MAGLQELRFPEEKPLLRGQDATELESSDAFLLAADTDWKEHDIETPYGLLHVVIRGSPKGNRPAILTYHD VGLNHKLCFNTFFNFEDMQEITKHFVVCHVDAPGQQVGASQFPQGYQFPSMEQLAAMLPSVVQHFGFKYV IGIGVGAGAYVLAKFALIFPDLVEGLVLVNIDPNGKGWIDWAATKLSGLTSTLPDTVLSHLFSQEELVNN TELVQSYRQQIGNVVNQANLQLFWNMYNSRRDLDINRPGTVPNAKTLRCPVMLVVGDNAPAEDGVVECNS KLDPTTTTFLKMADSGGLPQVTQPGKLTEAFKYFLQGMGYMPSASMTRLARSRTASLTSASSVDGSRPQA CTHSESSEGLGQVNHTMEVSC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_075061 |
| RefSeq Size | 3453 |
| RefSeq ORF | 1113 |
| Synonyms | BDM1; SMAP-8; SMAP8 |
| Locus ID | 65009 |
| Cytogenetics | 16q21 |
| Summary | This gene is a member of the N-myc downregulated gene family which belongs to the alpha/beta hydrolase superfamily. The protein encoded by this gene is a cytoplasmic protein that is required for cell cycle progression and survival in primary astrocytes and may be involved in the regulation of mitogenic signalling in vascular smooth muscles cells. Alternative splicing results in multiple transcripts encoding different isoforms.[provided by RefSeq, Jun 2011] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402788 | NDRG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411459 | NDRG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427222 | NDRG4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402788 | Transient overexpression lysate of NDRG family member 4 (NDRG4), transcript variant 1 |
CNY 3,080.00 |
|
| LY411459 | Transient overexpression lysate of NDRG family member 4 (NDRG4), transcript variant 3 |
CNY 3,080.00 |
|
| LY427222 | Transient overexpression lysate of NDRG family member 4 (NDRG4), transcript variant 2 |
CNY 3,080.00 |
|
| PH321058 | NDRG4 MS Standard C13 and N15-labeled recombinant protein (NP_065198) |
CNY 19,520.00 |
|
| TP321058 | Recombinant protein of human NDRG family member 4 (NDRG4), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP321301 | Recombinant protein of human NDRG family member 4 (NDRG4), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP761034 | Purified recombinant protein of Human NDRG family member 4 (NDRG4), transcript variant 2, full length, with N-terminal HIS tag, expressed in E.coli, 50ug |
CNY 2,040.00 |
