NGF (NM_002506) Human Mass Spec Standard
CAT#: PH321463
NGF MS Standard C13 and N15-labeled recombinant protein (NP_002497)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | NGF MS Standard C13 and N15-labeled recombinant protein (NP_002497) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221463 |
Predicted MW | 26.99 kDa |
Protein Sequence |
>RC221463 representing NM_002506
Red=Cloning site Green=Tags(s) MSMLFYTLITAFLIGIQAEPHSESNVPAGHTIPQVHWTKLQHSLDTALRRARSAPAAAIAARVAGQTRNI TVDPRLFKKRRLRSPRVLFSTQPPREAADTQDLDFEVGGAAPFNRTHRSKRSSSHPIFHRGEFSVCDSVS VWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKA LTMDGKQAAWRFIRIDTACVCVLSRKAVRRA SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_002497 |
RefSeq Size | 1052 |
RefSeq ORF | 723 |
Synonyms | Beta-NGF; HSAN5; NGFB |
Locus ID | 4803 |
Cytogenetics | 1p13.2 |
Summary | This gene is a member of the NGF-beta family and encodes a secreted protein which homodimerizes and is incorporated into a larger complex. This protein has nerve growth stimulating activity and the complex is involved in the regulation of growth and the differentiation of sympathetic and certain sensory neurons. Mutations in this gene have been associated with hereditary sensory and autonomic neuropathy, type 5 (HSAN5), and dysregulation of this gene's expression is associated with allergic rhinitis. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Secreted Protein |
Protein Pathways | Apoptosis, MAPK signaling pathway, Neurotrophin signaling pathway |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
TP321463 | Recombinant protein of human nerve growth factor (beta polypeptide) (NGF), 20 µg |
CNY 2,900.00 |
|
TP720591 | Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF) |
CNY 3,140.00 |
|
TP721236 | Purified recombinant protein of Human nerve growth factor (beta polypeptide) (NGF) |
CNY 3,140.00 |