CD105 (ENG) (NM_000118) Human Mass Spec Standard
CAT#: PH321699
ENG MS Standard C13 and N15-labeled recombinant protein (NP_000109)
View other "CD105" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | ENG MS Standard C13 and N15-labeled recombinant protein (NP_000109) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221699 |
Predicted MW | 67.78 kDa |
Protein Sequence |
>RC221699 representing NM_000118
Red=Cloning site Green=Tags(s) MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLE FPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPS FPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFK IFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTC SPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASM ISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQL DSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQ DQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTREYPRPPQSGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_000109 |
RefSeq Size | 3142 |
RefSeq ORF | 1884 |
Synonyms | END; HHT1; ORW1 |
Locus ID | 2022 |
Cytogenetics | 9q34.11 |
Summary | This gene encodes a homodimeric transmembrane protein which is a major glycoprotein of the vascular endothelium. This protein is a component of the transforming growth factor beta receptor complex and it binds to the beta1 and beta3 peptides with high affinity. Mutations in this gene cause hereditary hemorrhagic telangiectasia, also known as Osler-Rendu-Weber syndrome 1, an autosomal dominant multisystemic vascular dysplasia. This gene may also be involved in preeclampsia and several types of cancer. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, May 2013] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424919 | ENG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC426509 | ENG HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424919 | Transient overexpression lysate of endoglin (ENG), transcript variant 2 |
CNY 4,840.00 |
|
LY426509 | Transient overexpression lysate of endoglin (ENG), transcript variant 1 |
CNY 3,080.00 |
|
PH326069 | ENG MS Standard C13 and N15-labeled recombinant protein (NP_001108225) |
CNY 14,250.00 |
|
TP321699 | Recombinant protein of human endoglin (ENG), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP326069 | Purified recombinant protein of Homo sapiens endoglin (ENG), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP721000 | Purified recombinant protein of Human endoglin (ENG), transcript variant 2 |
CNY 3,140.00 |