United States
Germany
Japan
United Kingdom
China
NHP2L1 (SNU13) (NM_001003796) Human Mass Spec Standard
CAT＃: PH321735
NHP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003796)
View other "NHP2L1" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | NHP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_001003796) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221735 |
| Predicted MW | 14.2 kDa |
| Protein Sequence |
>RC221735 protein sequence
Red=Cloning site Green=Tags(s) MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLP LLCEDKNVPYVFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001003796 |
| RefSeq Size | 1520 |
| RefSeq ORF | 384 |
| Synonyms | 15.5K; FA-1; FA1; NHP2L1; NHPX; OTK27; SNRNP15-5; SPAG12; SSFA1 |
| Locus ID | 4809 |
| Cytogenetics | 22q13.2 |
| Summary | Originally named because of its sequence similarity to the Saccharomyces cerevisiae NHP2 (non-histone protein 2), this protein appears to be a highly conserved nuclear protein that is a component of the [U4/U6.U5] tri-snRNP. It binds to the 5' stem-loop of U4 snRNA. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Pathways | Spliceosome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC417581 | NHP2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC424011 | NHP2L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY417581 | Transient overexpression lysate of NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 1 |
CNY 3,080.00 |
|
| LY424011 | Transient overexpression lysate of NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2 |
CNY 3,080.00 |
|
| PH324143 | NHP2L1 MS Standard C13 and N15-labeled recombinant protein (NP_004999) |
CNY 19,520.00 |
|
| TP321735 | Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP324143 | Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP720213 | Recombinant protein of human NHP2 non-histone chromosome protein 2-like 1 (S. cerevisiae) (NHP2L1), transcript variant 2 |
CNY 1,800.00 |
