FUSIP1 (SRSF10) (NM_006625) Human Mass Spec Standard
CAT#: PH321759
SFRS13A MS Standard C13 and N15-labeled recombinant protein (NP_006616)
View other "FUSIP1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SFRS13A MS Standard C13 and N15-labeled recombinant protein (NP_006616) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC221759 |
Predicted MW | 22.2 kDa |
Protein Sequence |
>RC221759 protein sequence
Red=Cloning site Green=Tags(s) MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHN LDRKWICGRQIEIQFAQGDRKTPNQMKAKEGRNVYSSSRYDDYDRYRRSRSRSYERRRSRSRSFDYNYRR SYSPRNSRPTGRPRRSRSHSDNDRPNCSWNTQYSSAYYTSRKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_006616 |
RefSeq Size | 4076 |
RefSeq ORF | 549 |
Synonyms | FUSIP1; FUSIP2; NSSR; PPP1R149; SFRS13; SFRS13A; SRp38; SRrp40; TASR; TASR1; TASR2 |
Locus ID | 10772 |
Cytogenetics | 1p36.11 |
Summary | This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein interacts with the oncoprotein TLS, and abrogates the influence of TLS on adenovirus E1A pre-mRNA splicing. This gene has pseudogenes on chromosomes 4, 9, 14, 18, and 20. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Transcription Factors |
Protein Pathways | Spliceosome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC416515 | SRSF10 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY416515 | Transient overexpression lysate of splicing factor, arginine/serine-rich 13A (SFRS13A), transcript variant 1 |
CNY 3,080.00 |
|
TP321759 | Recombinant protein of human FUS interacting protein (serine/arginine-rich) 1 (FUSIP1), transcript variant 1, 20 µg |
CNY 2,900.00 |