United States
Germany
Japan
United Kingdom
China
MID1IP1 (NM_001098791) Human Mass Spec Standard
CAT＃: PH321845
MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092261)
View other "MID1IP1" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 3,080.00
CNY 6,281.00
Specifications
| Product Data | |
| Description | MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092261) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221845 |
| Predicted MW | 20.2 kDa |
| Protein Sequence |
>RC221845 protein sequence
Red=Cloning site Green=Tags(s) MMQICDTYNQKHSLFNAMNRFIGAVNNMDQTVMVPSLLRDVPLADPGLDNDVGVEVGGSGGCLEERTPPV PDSGSANGSFFAPSRDMYSHYVLLKSIRNDIEWGVLHQPPPPAGSEEGSAWKSKDILVDLGHLEGADAGE EDLEQQFHYHLRGLHTVLSKLTRKANILTNRYKQEIGFGNWGH myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001092261 |
| RefSeq Size | 1916 |
| RefSeq ORF | 549 |
| Synonyms | G12-like; MIG12; S14R; STRAIT11499; THRSPL |
| Locus ID | 58526 |
| Cytogenetics | Xp11.4 |
| Summary | Plays a role in the regulation of lipogenesis in liver. Up-regulates ACACA enzyme activity. Required for efficient lipid biosynthesis, including triacylglycerol, diacylglycerol and phospholipid. Involved in stabilization of microtubules (By similarity).[UniProtKB/Swiss-Prot Function] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400445 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC411994 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC420677 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429650 | MID1IP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400445 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3 |
CNY 3,080.00 |
|
| LY411994 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1 |
CNY 3,080.00 |
|
| LY420677 | Transient overexpression lysate of MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2 |
CNY 3,080.00 |
|
| PH303444 | MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_067065) |
CNY 19,520.00 |
|
| PH317566 | MID1IP1 MS Standard C13 and N15-labeled recombinant protein (NP_001092260) |
CNY 19,520.00 |
|
| TP303444 | Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP317566 | Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP321845 | Recombinant protein of human MID1 interacting protein 1 (gastrulation specific G12 homolog (zebrafish)) (MID1IP1), transcript variant 3, 20 µg |
CNY 2,900.00 |
其它MID1IP1产品
