United States
Germany
Japan
United Kingdom
China
CPLX2 (NM_001008220) Human Mass Spec Standard
CAT＃: PH321947
CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_001008221)
View other "CPLX2" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_001008221) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221947 |
| Predicted MW | 15.4 kDa |
| Protein Sequence |
>RC221947 protein sequence
Red=Cloning site Green=Tags(s) MDFVMKQALGGATKDMGKMLGGEEEKDPDAQKKEEERQEALRQQEEERKAKHARMEAEREKVRQQIRDKY GLKKKEEKEAEEKAALEQPCEGSLTRPKKAIPAGCGDEEEEEEESILDTVLKYLPGPLQDMFKK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001008221 |
| RefSeq Size | 4676 |
| RefSeq ORF | 402 |
| Synonyms | 921-L; CPX-2; CPX2; Hfb1 |
| Locus ID | 10814 |
| Cytogenetics | 5q35.2 |
| Summary | Proteins encoded by the complexin/synaphin gene family are cytosolic proteins that function in synaptic vesicle exocytosis. These proteins bind syntaxin, part of the SNAP receptor. The protein product of this gene binds to the SNAP receptor complex and disrupts it, allowing transmitter release. Two transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC416505 | CPLX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423397 | CPLX2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY416505 | Transient overexpression lysate of complexin 2 (CPLX2), transcript variant 1 |
CNY 3,080.00 |
|
| LY423397 | Transient overexpression lysate of complexin 2 (CPLX2), transcript variant 2 |
CNY 3,080.00 |
|
| PH310806 | CPLX2 MS Standard C13 and N15-labeled recombinant protein (NP_006641) |
CNY 19,520.00 |
|
| TP310806 | Recombinant protein of human complexin 2 (CPLX2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP321947 | Recombinant protein of human complexin 2 (CPLX2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP710112 | Recombinant protein of human human complexin 2 (CPLX2), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9 cells |
CNY 4,020.00 |
