United States
Germany
Japan
United Kingdom
China
Repulsive Guidance Molecule A (RGMA) (NM_020211) Human Mass Spec Standard
CAT＃: PH321996
RGMA MS Standard C13 and N15-labeled recombinant protein (NP_064596)
View other "Repulsive Guidance Molecule A" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | RGMA MS Standard C13 and N15-labeled recombinant protein (NP_064596) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC221996 |
| Predicted MW | 49.2 kDa |
| Protein Sequence |
>RC221996 representing NM_020211
Red=Cloning site Green=Tags(s) MQPPRERLVVTGRAGWMGMGRGAGRSALGFWPTLAFLLCSFPAATSPCKILKCNSEFWSATSGSHAPASD DTPEFCAALRSYALCTRRTARTCRGDLAYHSAVHGIEDLMSQHNCSKDGPTSQPRLRTLPPAGDSQERSD SPEICHYEKSFHKHSATPNYTHCGLFGDPHLRTFTDRFQTCKVQGAWPLIDNNYLNVQVTNTPVLPGSAA TATSKLTIIFKNFQECVDQKVYQAEMDELPAAFVDGSKNGGDKHGANSLKITEKVSGQHVEIQAKYIGTT IVVRQVGRYLTFAVRMPEEVVNAVEDWDSQGLYLCLRGCPLNQQIDFQAFHTNAEGTGARRLAAASPAPT APETFPYETAVAKCKEKLPVEDLYYQACVFDLLTTGDVNFTLAAYYALEDVKMLHSNKDKLHLYERTRDL PGRAAAGLPLAPRPLLGALVPLLALLPVFCSGP SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_064596 |
| RefSeq Size | 3216 |
| RefSeq ORF | 1359 |
| Synonyms | RGM |
| Locus ID | 56963 |
| Cytogenetics | 15q26.1 |
| Summary | This gene encodes a member of the repulsive guidance molecule family. The encoded protein is a glycosylphosphatidylinositol-anchored glycoprotein that functions as an axon guidance protein in the developing and adult central nervous system. This protein may also function as a tumor suppressor in some cancers. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402781 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC433077 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433079 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC433119 | RGMA HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402781 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 4 |
CNY 4,840.00 |
|
| LY433077 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 3 |
CNY 3,080.00 |
|
| LY433079 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 2 |
CNY 3,080.00 |
|
| LY433119 | Transient overexpression lysate of RGM domain family, member A (RGMA), transcript variant 1 |
CNY 3,080.00 |
|
| TP321996 | Recombinant protein of human RGM domain family, member A (RGMA), 20 µg |
CNY 2,900.00 |
|
| TP721172 | Purified recombinant protein of Human RGM domain family, member A (RGMA), transcript variant 4 |
CNY 3,140.00 |
其它Repulsive Guidance Molecule A产品
