DMAP1 (NM_019100) Human Mass Spec Standard
CAT#: PH322239
DMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_061973)
View other "DMAP1" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Specifications
Product Data | |
Description | DMAP1 MS Standard C13 and N15-labeled recombinant protein (NP_061973) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222239 |
Predicted MW | 53 kDa |
Protein Sequence |
>RC222239 protein sequence
Red=Cloning site Green=Tags(s) MATGADVRDILELGGPEGDAASGTISKKDIINPDKKKSKKSSETLTFKRPEGMHREVYALLYSDKKDAPP LLPSDTGQGYRTVKAKLGSKKVRPWKWMPFTNPARKDGAMFFHWRRAAEEGKDYPFARFNKTVQVPVYSE QEYQLYLHDDAWTKAETDHLFDLSRRFDLRFVVIHDRYDHQQFKKRSVEDLKERYYHICAKLANVRAVPG TDLKIPVFDAGHERRRKEQLERLYNRTPEQVAEEEYLLQELRKIEARKKEREKRSQDLQKLITAADTTAE QRRTERKAPKKKLPQKKEAEKPAVPETAGIKFPDFKSAGVTLRSQRMKLPSSVGQKKIKALEQMLLELGV ELSPTPTEELVHMFNELRSDLVLLYELKQACANCEYELQMLRHRHEALARAGVLGGPATPASGPGPASAE PAVTEPGLGPDPKDTIIDVVGAPLTPNSRKRRESASSSSSVKKAKKP myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_061973 |
RefSeq Size | 1784 |
RefSeq ORF | 1401 |
Synonyms | DNMAP1; DNMTAP1; EAF2; MEAF2; SWC4 |
Locus ID | 55929 |
Cytogenetics | 1p34.1 |
Summary | This gene encodes a subunit of several, distinct complexes involved in the repression or activation of transcription. The encoded protein can independently repress transcription and is targeted to replication foci throughout S phase by interacting directly with the N-terminus of DNA methyltransferase 1. During late S phase, histone deacetylase 2 is added to this complex, providing a means to deacetylate histones in transcriptionally inactive heterochromatin following replication. The encoded protein is also a component of the nucleosome acetyltransferase of H4 complex and interacts with the transcriptional corepressor tumor susceptibility gene 101 and the pro-apoptotic death-associated protein 6, among others. Alternatively spliced transcript variants encoding the same protein have been described. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC412758 | DMAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC421951 | DMAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC421952 | DMAP1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY412758 | Transient overexpression lysate of DNA methyltransferase 1 associated protein 1 (DMAP1), transcript variant 1 |
CNY 4,840.00 |
|
LY421951 | Transient overexpression lysate of DNA methyltransferase 1 associated protein 1 (DMAP1), transcript variant 2 |
CNY 3,080.00 |
|
LY421952 | Transient overexpression lysate of DNA methyltransferase 1 associated protein 1 (DMAP1), transcript variant 3 |
CNY 3,080.00 |
|
TP322239 | Recombinant protein of human DNA methyltransferase 1 associated protein 1 (DMAP1), transcript variant 1, 20 µg |
CNY 2,900.00 |