TPSG1 (NM_012467) Human Mass Spec Standard
CAT#: PH322359
TPSG1 MS Standard C13 and N15-labeled recombinant protein (NP_036599)
View other "TPSG1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | TPSG1 MS Standard C13 and N15-labeled recombinant protein (NP_036599) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC222359 |
Predicted MW | 33.76 kDa |
Protein Sequence |
>RC222359 representing NM_012467
Red=Cloning site Green=Tags(s) MALGACGLLLLLAVPGVSLRTLQPGCGRPQVSDAGGRIVGGHAAPAGAWPWQASLRLRRMHVCGGSLLSP QWVLTAAHCFSGSLNSSDYQVHLGELEITLSPHFSTVRQIILHSSPSGQPGTSGDIALVELSVPVTLSSR ILPVCLPEASDDFCPGIRCSVTGWGYTREGEPLPPPYSLREVKVSVVDTETCRRDYPGPGGSILQPDMLC ARGPGDACQDDSGGPLVCQVNGAWVQAGIVSWGEGCGRPNRPGVYTRVPAYVNWIRRHITASGGSESGYP RLPLLAGFFLPGLFLLLVSCVLLAKCLLHPSADGTPFPAPD myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_036599 |
RefSeq Size | 1124 |
RefSeq ORF | 963 |
Synonyms | PRSS31; TMT; trpA |
Locus ID | 25823 |
Cytogenetics | 16p13.3 |
Summary | Tryptases comprise a family of trypsin-like serine proteases, the peptidase family S1. Tryptases are enzymatically active only as heparin-stabilized tetramers, and they are resistant to all known endogenous proteinase inhibitors. Several tryptase genes are clustered on chromosome 16p13.3. There is uncertainty regarding the number of genes in this cluster. Currently four functional genes - alpha I, beta I, beta II and gamma I - have been identified. And beta I has an allelic variant named alpha II, beta II has an allelic variant beta III, also gamma I has an allelic variant gamma II. Beta tryptases appear to be the main isoenzymes expressed in mast cells; whereas in basophils, alpha-tryptases predominant. This gene differs from other members of the tryptase gene family in that it has C-terminal hydrophobic domain, which may serve as a membrane anchor. Tryptases have been implicated as mediators in the pathogenesis of asthma and other allergic and inflammatory disorders. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Transmembrane |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402219 | TPSG1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402219 | Transient overexpression lysate of tryptase gamma 1 (TPSG1) |
CNY 3,080.00 |
|
TP322359 | Recombinant protein of human tryptase gamma 1 (TPSG1), 20 µg |
CNY 2,900.00 |