United States
Germany
Japan
United Kingdom
China
PICK1 (NM_012407) Human Mass Spec Standard
CAT＃: PH322869
PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_036539)
View other "PICK1" proteins (13)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_036539) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC222869 |
| Predicted MW | 46.6 kDa |
| Protein Sequence |
>RC222869 protein sequence
Red=Cloning site Green=Tags(s) MFADLDYDIEEDKLGIPTVPGKVTLQKDAQNLIGISIGGGAQYCPCLYIVQVFDNTPAALDGTVAAGDEI TGVNGRSIKGKTKVEVAKMIQEVKGEVTIHYNKLQADPKQGMSLDIVLKKVKHRLVENMSSGTADALGLS RAILCNDGLVKRLEELERTAELYKGMTEHTKNLLRAFYELSQTHRAFGDVFSVIGVREPQPAASEAFVKF ADAHRSIEKFGIRLLKTIKPMLTDLNTYLNKAIPDTRLTIKKYLDVKFEYLSYCLKVKEMDDEEYSCIAL GEPLYRVSTGNYEYRLILRCRQEARARFSQMRKDVLEKMELLDQKHVQDIVFQLQRLVSTMSKYYNDCYA VLRDADVFPIEVDLAHTTLAYGLNQEEFTDGEEEEEEEDTAAGEPSRDTRGAAGPLDKGGSWCDS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_036539 |
| RefSeq Size | 2224 |
| RefSeq ORF | 1245 |
| Synonyms | PICK; PRKCABP |
| Locus ID | 9463 |
| Cytogenetics | 22q13.1 |
| Summary | The protein encoded by this gene contains a PDZ domain, through which it interacts with protein kinase C, alpha (PRKCA). This protein may function as an adaptor that binds to and organizes the subcellular localization of a variety of membrane proteins. It has been shown to interact with multiple glutamate receptor subtypes, monoamine plasma membrane transporters, as well as non-voltage gated sodium channels, and may target PRKCA to these membrane proteins and thus regulate their distribution and function. This protein has also been found to act as an anchoring protein that specifically targets PRKCA to mitochondria in a ligand-specific manner. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jul 2008] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC415785 | PICK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422082 | PICK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC422083 | PICK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC425646 | PICK1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY415785 | Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 1 |
CNY 3,080.00 |
|
| LY422082 | Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 2 |
CNY 3,080.00 |
|
| LY422083 | Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 3 |
CNY 3,080.00 |
|
| LY425646 | Transient overexpression lysate of protein interacting with PRKCA 1 (PICK1), transcript variant 3 |
CNY 3,080.00 |
|
| PH303455 | PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034673) |
CNY 14,250.00 |
|
| PH322916 | PICK1 MS Standard C13 and N15-labeled recombinant protein (NP_001034672) |
CNY 19,520.00 |
|
| TP303455 | Purified recombinant protein of Homo sapiens protein interacting with PRKCA 1 (PICK1), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP322869 | Recombinant protein of human protein interacting with PRKCA 1 (PICK1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP322916 | Recombinant protein of human protein interacting with PRKCA 1 (PICK1), transcript variant 2, 20 µg |
CNY 2,900.00 |
