FUT8 (NM_178155) Human Mass Spec Standard
CAT#: PH323075
FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835368)
View other "FUT8" proteins (9)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835368) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223075 |
Predicted MW | 66.3 kDa |
Protein Sequence |
>RC223075 representing NM_178155
Red=Cloning site Green=Tags(s) MRPWTGSWRWIMLILFAWGTLLFYIGGHLVRDNDHPDHSSRELSKILAKLERLKQQNEDLRRMAESLRIP EGPIDQGPAIGRVRVLEEQLVKAKEQIENYKKQTRNGLGKDHEILRRRIENGAKELWFFLQSELKKLKNL EGNELQRHADEFLLDLGHHERSIMTDLYYLSQTDGAGDWREKEAKDLTELVQRRITYLQNPKDCSKAKKL VCNINKGCGYGCQLHHVVYCFMIAYGTQRTLILESQNWRYATGGWETVFRPVSETCTDRSGISTGHWSGE VKDKNVQVVELPIVDSLHPRPPYLPLAVPEDLADRLVRVHGDPAVWWVSQFVKYLIRPQPWLEKEIEEAT KKLGFKHPVIGVHVRRTDKVGTEAAFHPIEEYMVHVEEHFQLLARRMQVDKKRVYLATDDPSLLKEAKTK YPNYEFISDNSISWSAGLHNRYTENSLRGVILDIHFLSQADFLVCTFSSQVCRVAYEIMQTLHPDASANF HSLDDIYYFGGQNAHNQIAIYAHQPRTADEIPMEPGDIIGVAGNHWDGYSKGVNRKLGRTGLYPSYKVRE KIETVKYPTYPEAEK SGPTRTRRLEQKLISEEDLAANDILDYKDDDDKV |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_835368 |
RefSeq Size | 3775 |
RefSeq ORF | 1725 |
Synonyms | CDGF; CDGF1 |
Locus ID | 2530 |
Cytogenetics | 14q23.3 |
Summary | This gene encodes an enzyme belonging to the family of fucosyltransferases. The product of this gene catalyzes the transfer of fucose from GDP-fucose to N-linked type complex glycopeptides. This enzyme is distinct from other fucosyltransferases which catalyze alpha1-2, alpha1-3, and alpha1-4 fucose addition. The expression of this gene may contribute to the malignancy of cancer cells and to their invasive and metastatic capabilities. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2011] |
Protein Families | Transmembrane |
Protein Pathways | Keratan sulfate biosynthesis, Metabolic pathways, N-Glycan biosynthesis |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC406001 | FUT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC406002 | FUT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC406003 | FUT8 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY406001 | Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 2 |
CNY 4,840.00 |
|
LY406002 | Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1 |
CNY 4,840.00 |
|
LY406003 | Transient overexpression lysate of fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 3 |
CNY 4,840.00 |
|
PH312345 | FUT8 MS Standard C13 and N15-labeled recombinant protein (NP_835367) |
CNY 19,520.00 |
|
TP312345 | Recombinant protein of human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP323075 | Recombinant protein of human fucosyltransferase 8 (alpha (1,6) fucosyltransferase) (FUT8), transcript variant 1, 20 µg |
CNY 2,900.00 |