STARD4 (NM_139164) Human Mass Spec Standard
CAT#: PH323123
STARD4 MS Standard C13 and N15-labeled recombinant protein (NP_631903)
View other "STARD4" proteins (4)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 2,700.00
Specifications
Product Data | |
Description | STARD4 MS Standard C13 and N15-labeled recombinant protein (NP_631903) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223123 |
Predicted MW | 23.3 kDa |
Protein Sequence |
>RC223123 representing NM_139164
Red=Cloning site Green=Tags(s) MEGLSDVASFATKLKNTLIQYHSIEEDKWRVAKKTKDVTVWRKPSEEFNGYLYKAQGVIDDLVYSIIDHI RPGPCRLDWDSLMTSLDILENFEENCCVMRYTTAGQLWNIISPREFVDFSYTVGYKEGLLSCGISLDWDE KRPEFVRGYNHPCGWFCVPLKDNPNQSLLTGYIQTDLRGMIPQSAVDTAMASTLTNFYGDLRKAL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_631903 |
RefSeq Size | 2264 |
RefSeq ORF | 615 |
Locus ID | 134429 |
Cytogenetics | 5q22.1 |
Summary | Cholesterol homeostasis is regulated, at least in part, by sterol regulatory element (SRE)-binding proteins (e.g., SREBP1; MIM 184756) and by liver X receptors (e.g., LXRA; MIM 602423). Upon sterol depletion, LXRs are inactive and SREBPs are cleaved, after which they bind promoter SREs and activate genes involved in cholesterol biosynthesis and uptake. Sterol transport is mediated by vesicles or by soluble protein carriers, such as steroidogenic acute regulatory protein (STAR; MIM 600617). STAR is homologous to a family of proteins containing a 200- to 210-amino acid STAR-related lipid transfer (START) domain, including STARD4 (Soccio et al., 2002 [PubMed 12011452]).[supplied by OMIM, Mar 2008] |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408367 | STARD4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY408367 | Transient overexpression lysate of StAR-related lipid transfer (START) domain containing 4 (STARD4) |
CNY 3,080.00 |
|
TP323123 | Recombinant protein of human StAR-related lipid transfer (START) domain containing 4 (STARD4), 20 µg |
CNY 2,900.00 |
|
TP760684 | Purified recombinant protein of Human StAR-related lipid transfer (START) domain containing 4 (STARD4), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |