CTIP1 (BCL11A) (NM_138559) Human Mass Spec Standard
CAT#: PH323575
BCL11A MS Standard C13 and N15-labeled recombinant protein (NP_612569)
View other "CTIP1" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | BCL11A MS Standard C13 and N15-labeled recombinant protein (NP_612569) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223575 |
Predicted MW | 26.7 kDa |
Protein Sequence |
>RC223575 representing NM_138559
Red=Cloning site Green=Tags(s) MSRRKQGKPQHLSKREFSPEPLEAILTDDEPDHGPLGAPEGDHDLLTCGQCQMNFPLGDILIFIEHKRKQ CNGSLCLEKAVDKPPSPSPIEMKKASNPVEVGIQVTPEDDDCLSTSSRGICPKQEHIADKLLHWRGLSSP RSAHGALIPTPGMSAEYAPQGICKDEPSSYTCTTCKQPFTSAWFLLQHAQNTHGLRIYLESEHGSPLTPR VLHTPPFGVVPRELKMCGSFRMEAREPLSSEKI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_612569 |
RefSeq Size | 2358 |
RefSeq ORF | 729 |
Synonyms | BCL11A-L; BCL11a-M; BCL11A-S; BCL11A-XL; CTIP1; DILOS; EVI9; HBFQTL5; ZNF856 |
Locus ID | 53335 |
Cytogenetics | 2p16.1 |
Summary | This gene encodes a C2H2 type zinc-finger protein by its similarity to the mouse Bcl11a/Evi9 protein. The corresponding mouse gene is a common site of retroviral integration in myeloid leukemia, and may function as a leukemia disease gene, in part, through its interaction with BCL6. During hematopoietic cell differentiation, this gene is down-regulated. It is possibly involved in lymphoma pathogenesis since translocations associated with B-cell malignancies also deregulates its expression. Multiple transcript variants encoding several different isoforms have been found for this gene. [provided by RefSeq, Jul 2008] |
Protein Families | Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC408578 | BCL11A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC411466 | BCL11A HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LY408578 | Transient overexpression lysate of B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 3 |
CNY 3,080.00 |
|
LY411466 | Transient overexpression lysate of B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 1 |
CNY 4,840.00 |
|
TP323575 | Recombinant protein of human B-cell CLL/lymphoma 11A (zinc finger protein) (BCL11A), transcript variant 3, 20 µg |
CNY 2,900.00 |