BMF (NM_033503) Human Mass Spec Standard
CAT#: PH323634
BMF MS Standard C13 and N15-labeled recombinant protein (NP_277038)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | BMF MS Standard C13 and N15-labeled recombinant protein (NP_277038) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC223634 |
Predicted MW | 20.3 kDa |
Protein Sequence |
>RC223634 representing NM_033503
Red=Cloning site Green=Tags(s) MEPSQCVEELEDDVFQPEDGEPVTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKAT QTLSPASPSPGVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAVLPIGEQPPEGQWQHQAEVQIARKLQCI ADQFHRLHVQQHQQNQNRVWWQILLFLHNLALNGEENRNGAGPR myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_277038 |
RefSeq Size | 4551 |
RefSeq ORF | 552 |
Locus ID | 90427 |
Cytogenetics | 15q15.1 |
Summary | The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein contains a single BCL2 homology domain 3 (BH3), and has been shown to bind BCL2 proteins and function as an apoptotic activator. This protein is found to be sequestered to myosin V motors by its association with dynein light chain 2, which may be important for sensing intracellular damage and triggering apoptosis. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC424040 | BMF HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY424040 | Transient overexpression lysate of Bcl2 modifying factor (BMF), transcript variant 1 |
CNY 3,080.00 |
|
TP323634 | Recombinant protein of human Bcl2 modifying factor (BMF), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760195 | Recombinant protein of human Bcl2 modifying factor (BMF), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |