United States
Germany
Japan
United Kingdom
China
Deoxyribonuclease I like 1 (DNASE1L1) (NM_001009934) Human Mass Spec Standard
CAT＃: PH323658
DNASE1L1 MS Standard C13 and N15-labeled recombinant protein (NP_001009934)
View other "Deoxyribonuclease I like 1" proteins (12)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | DNASE1L1 MS Standard C13 and N15-labeled recombinant protein (NP_001009934) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC223658 |
| Predicted MW | 33.9 kDa |
| Protein Sequence |
>RC223658 protein sequence
Red=Cloning site Green=Tags(s) MHYPTALLFLILANGAQAFRICAFNAQRLTLAKVAREQVMDTLVRILARCDIMVLQEVVDSSGSAIPLLL RELNRFDGSGPYSTLSSPQLGRSTYMETYVYFYRSHKTQVLSSYVYNDEDDVFAREPFVAQFSLPSNVLP SLVLVPLHTTPKAVEKELNALYDVFLEVSQHWQSKDVILLGDFNADCASLTKKRLDKLELRTEPGFHWVI ADGEDTTVRASTHCTYDRVVLHGERCRSLLHTAAAFDFPTSFQLTEEEALNISDHYPVEVELKLSQAHSV QPLSLTVLLLLSLLSPQLCPAA myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001009934 |
| RefSeq Size | 2665 |
| RefSeq ORF | 906 |
| Synonyms | DNAS1L1; DNASEX; DNL1L; G4.8; XIB |
| Locus ID | 1774 |
| Cytogenetics | Xq28 |
| Summary | This gene encodes a deoxyribonuclease protein that shows high sequence similarity to DNase I. The encoded protein is localized to the endoplasmic reticulum and modified by N-linked glycosylation. Alternate transcriptional splice variants encoding the same protein have been observed. [provided by RefSeq, Jan 2015] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402010 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423155 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423156 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC423157 | DNASE1L1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402010 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 1 |
CNY 3,080.00 |
|
| LY423155 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 2 |
CNY 3,080.00 |
|
| LY423156 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 3 |
CNY 3,080.00 |
|
| LY423157 | Transient overexpression lysate of deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 4 |
CNY 3,080.00 |
|
| TP323658 | Recombinant protein of human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 4, 20 µg |
CNY 2,900.00 |
|
| TP760294 | Recombinant protein of human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 1, full length, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
|
| TP760968 | Purified recombinant protein of Human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 2, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
|
| TP761603 | Purified recombinant protein of Human deoxyribonuclease I-like 1 (DNASE1L1), transcript variant 2, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
其它Deoxyribonuclease I like 1产品
