CD252 (TNFSF4) (NM_003326) Human Mass Spec Standard
CAT#: PH324021
TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317)
View other "CD252" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 3,080.00
CNY 1,999.00
CNY 3,340.00
Specifications
Product Data | |
Description | TNFSF4 MS Standard C13 and N15-labeled recombinant protein (NP_003317) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224021 |
Predicted MW | 20.9 kDa |
Protein Sequence |
>RC224021 representing NM_003326
Red=Cloning site Green=Tags(s) MERVQPLEENVGNAARPRFERNKLLLVASVIQGLGLLLCFTYICLHFSALQVSHRYPRIQSIKVQFTEYK KEKGFILTSQKEDEIMKVQNNSVIINCDGFYLISLKGYFSQEVNISLHYQKDEEPLFQLKKVRSVNSLMV ASLTYKDKVYLNVTTDNTSLDDFHVNGGELILIHQNPGEFCVL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_003317 |
RefSeq Size | 3510 |
RefSeq ORF | 549 |
Synonyms | CD134L; CD252; GP34; OX-40L; OX4OL; TNLG2B; TXGP1 |
Locus ID | 7292 |
Cytogenetics | 1q25.1 |
Summary | This gene encodes a cytokine of the tumor necrosis factor (TNF) ligand family. The encoded protein functions in T cell antigen-presenting cell (APC) interactions and mediates adhesion of activated T cells to endothelial cells. Polymorphisms in this gene have been associated with Sjogren's syndrome and systemic lupus erythematosus. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014] |
Protein Families | Druggable Genome, Transmembrane |
Protein Pathways | Cytokine-cytokine receptor interaction |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401143 | TNFSF4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401143 | Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4) |
CNY 3,080.00 |
|
TP324021 | Recombinant protein of human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4), 20 µg |
CNY 2,900.00 |
|
TP700285 | Purified recombinant protein of human tumor necrosis factor (ligand) superfamily, member 4 (TNFSF4), with C-terminal Fc tag, expressed in human cells, 20 µg |
CNY 6,650.00 |
|
TP723944 | Human OX40L Protein, mFc-His tag |
CNY 5,249.00 |