SFTPB (NM_198843) Human Mass Spec Standard
CAT#: PH324088
SFTPB MS Standard C13 and N15-labeled recombinant protein (NP_942140)
View other "SFTPB" proteins (5)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | SFTPB MS Standard C13 and N15-labeled recombinant protein (NP_942140) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC224088 |
Predicted MW | 42.1 kDa |
Protein Sequence |
>RC224088 protein sequence
Red=Cloning site Green=Tags(s) MAESHLLQWLLLLLPTLCGPGTAAWTTSSLACAQGPEFWCQSLEQALQCRALGHCLQEVWGHVGADDLCQ ECEDIVHILNKMAKEAIFQDTMRKFLEQECNVLPLKLLMPQCNQVLDDYFPLVIDYFQNQTDSNGICMHL GLCKSRQPEPEQEPGMSDPLPKPLRDPLPDPLLDKLVLPVLPGALQARPGPHTQDLSEQQFPIPLPYCWL CRALIKRIQAMIPKGALAVAVAQVCRVVPLVAGGICQCLAERYSVILLDTLLGRMLPQLVCRLVLRCSMD DSAGPRSPTGEWLPRDSECHLCMSVTTQAGNSSEQAIPQAMLQACVGSWLDREKCKQFVEQHTPQLLTLV PRGWDAHTTCQALGVCGTMSSPLQCIHSPDL myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_942140 |
RefSeq Size | 2854 |
RefSeq ORF | 1143 |
Synonyms | PSP-B; SFTB3; SFTP3; SMDP1; SP-B |
Locus ID | 6439 |
Cytogenetics | 2p11.2 |
Summary | This gene encodes the pulmonary-associated surfactant protein B (SPB), an amphipathic surfactant protein essential for lung function and homeostasis after birth. Pulmonary surfactant is a surface-active lipoprotein complex composed of 90% lipids and 10% proteins which include plasma proteins and apolipoproteins SPA, SPB, SPC and SPD. The surfactant is secreted by the alveolar cells of the lung and maintains the stability of pulmonary tissue by reducing the surface tension of fluids that coat the lung. The SPB enhances the rate of spreading and increases the stability of surfactant monolayers in vitro. Multiple mutations in this gene have been identified, which cause pulmonary surfactant metabolism dysfunction type 1, also called pulmonary alveolar proteinosis due to surfactant protein B deficiency, and are associated with fatal respiratory distress in the neonatal period. Alternatively spliced transcript variants encoding the same protein have been identified.[provided by RefSeq, Feb 2010] |
Protein Families | Druggable Genome, Secreted Protein |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC404785 | SFTPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC424653 | SFTPB HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY404785 | Transient overexpression lysate of surfactant protein B (SFTPB), transcript variant 2 |
CNY 3,080.00 |
|
LY424653 | Transient overexpression lysate of surfactant protein B (SFTPB), transcript variant 1 |
CNY 3,080.00 |
|
TP324088 | Recombinant protein of human surfactant protein B (SFTPB), transcript variant 2, 20 µg |
CNY 2,900.00 |