United States
Germany
Japan
United Kingdom
China
DIABLO (NM_138930) Human Mass Spec Standard
CAT＃: PH324145
DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620308)
View other "DIABLO" proteins (8)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
Specifications
| Product Data | |
| Description | DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620308) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC224145 |
| Predicted MW | 21.7 kDa |
| Protein Sequence |
>RC224145 representing NM_138930
Red=Cloning site Green=Tags(s) MKSDFYFQKSEPHSLSSEALMRRAVSLVTDSTSTFLSQTTYALIEAITEYTKAVYTLTSLYRQYTSLLGK MNSEEEDEVWQVIIGARAEMTSKHQEYLKLETTWMTAVGLSEMAAEAAYQTGADQASITARNHIQLVKLQ VEEVHQLSRKAETKLAEAQIEELRQKTQEEGEERAESEQEAYLRED myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_620308 |
| RefSeq Size | 2455 |
| RefSeq ORF | 558 |
| Synonyms | DFNA64; SMAC |
| Locus ID | 56616 |
| Cytogenetics | 12q24.31 |
| Summary | This gene encodes an inhibitor of apoptosis protein (IAP)-binding protein. The encoded mitochondrial protein enters the cytosol when cells undergo apoptosis, and allows activation of caspases by binding to inhibitor of apoptosis proteins. Overexpression of the encoded protein sensitizes tumor cells to apoptosis. A mutation in this gene is associated with young-adult onset of nonsyndromic deafness-64. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, May 2013] |
| Protein Families | Transmembrane |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC408473 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412673 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC429603 | DIABLO HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY408473 | Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2 |
CNY 3,080.00 |
|
| LY412673 | Transient overexpression lysate of diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 1 |
CNY 3,080.00 |
|
| PH324190 | DIABLO MS Standard C13 and N15-labeled recombinant protein (NP_620307) |
CNY 19,520.00 |
|
| TP324145 | Purified recombinant protein of Homo sapiens diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP324190 | Recombinant protein of human diablo homolog (Drosophila) (DIABLO), nuclear gene encoding mitochondrial protein, transcript variant 3, 20 µg |
CNY 2,900.00 |
