United States
Germany
Japan
United Kingdom
China
EEF1D (NM_001130055) Human Mass Spec Standard
CAT＃: PH325386
EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001123527)
View other "EEF1D" proteins (14)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 4,840.00
Specifications
| Product Data | |
| Description | EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001123527) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC225386 |
| Predicted MW | 30.9 kDa |
| Protein Sequence |
>RC225386 representing NM_001130055
Red=Cloning site Green=Tags(s) MATNFLAHEKIWFDKFKYDDAERRFYEQMNGPVAGASRQENGASVILRDIARARENIQKSLAGSSGPGAS SGTSGDHGELVVRIASLEVENQSLRGVVQELQQAISKLEARLNVLEKSSPGHRATAPQTQHVSPMRQVEP PAKKPATPAEDDEDDDIDLFGSDNEEEDKEAAQLREERLRQYAEKKAKKPALVAKSSILLDVKPWDDETD MAQLEACVRSIQLDGLVWGASKLVPVGYGIRKLQIQCVVEDDKVGTDLLEEEITKFEEHVQSVDIAAFNK I myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001123527 |
| RefSeq ORF | 843 |
| Synonyms | EF-1D; EF1D; FP1047 |
| Locus ID | 1936 |
| Cytogenetics | 8q24.3 |
| Summary | This gene encodes a subunit of the elongation factor-1 complex, which is responsible for the enzymatic delivery of aminoacyl tRNAs to the ribosome. This subunit, delta, functions as guanine nucleotide exchange factor. It is reported that following HIV-1 infection, this subunit interacts with HIV-1 Tat. This interaction results in repression of translation of host cell proteins and enhanced translation of viral proteins. Several alternatively spliced transcript variants encoding multiple isoforms have been found for this gene. Related pseudogenes have been defined on chromosomes 1, 6, 7, 9, 11, 13, 17, 19.[provided by RefSeq, Aug 2010] |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC410171 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
| LC419621 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427131 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427133 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427135 | EEF1D HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY410171 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1 |
CNY 4,840.00 |
|
| LY419621 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2 |
CNY 3,080.00 |
|
| LY427131 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 3 |
CNY 3,080.00 |
|
| LY427133 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5 |
CNY 3,080.00 |
|
| LY427135 | Transient overexpression lysate of eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 6 |
CNY 3,080.00 |
|
| PH303202 | EEF1D MS Standard C13 and N15-labeled recombinant protein (NP_001951) |
CNY 19,520.00 |
|
| TP303202 | Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP325386 | Recombinant protein of human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP760795 | Purified recombinant protein of Human eukaryotic translation elongation factor 1 delta (guanine nucleotide exchange protein) (EEF1D), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug |
CNY 2,040.00 |
