United States
Germany
Japan
United Kingdom
China
CTPS2 (NM_001144002) Human Mass Spec Standard
CAT＃: PH326565
CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137474)
View other "CTPS2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137474) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226565 |
| Predicted MW | 65.7 kDa |
| Protein Sequence |
>RC226565 protein sequence
Red=Cloning site Green=Tags(s) MKYILVTGGVISGIGKGIIASSIGTILKSCGLRVTAIKIDPYINIDAGTFSPYEHGEVFVLNDGGEVDLD LGNYERFLDINLYKDNNITTGKIYQHVINKERRGDYLGKTVQVVPHITDAVQEWVMNQAKVPVDGNKEEP QICVIELGGTIGDIEGMPFVEAFRQFQFKAKRENFCNIHVSLVPQLSATGEQKTKPTQNSVRALRGLGLS PDLIVCRSSTPIEMAVKEKISMFCHVNPEQVICIHDVSSTYRVPVLLEEQSIVKYFKERLHLPIGDSASN LLFKWRNMADRYERLQKICSIALVGKYTKLRDCYASVFKALEHSALAINHKLNLMYIDSIDLEKITETED PVKFHEAWQKLCKADGILVPGGFGIRGTLGKLQAISWARTKKIPFLGVCLGMQLAVIEFARNCLNLKDAD STEFRPNAPVPLVIDMPEHNPGNLGGTMRLGIRRTVFKTENSILRKLYGDVPFIEERHRHRFEVNPNLIK QFEQNDLSFVGQDVDGDRMEIIELANHPYFVGVQFHPEFSSRPMKPSPPYLGLLLAATGNLNAYLQQGCK LSSSDRYSDASDDSFSEPRIAELEIS myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001137474 |
| RefSeq Size | 4334 |
| RefSeq ORF | 1758 |
| Synonyms | GATD5B |
| Locus ID | 56474 |
| Cytogenetics | Xp22.2 |
| Summary | The protein encoded by this gene catalyzes the formation of CTP from UTP with the concomitant deamination of glutamine to glutamate. This protein is the rate-limiting enzyme in the synthesis of cytosine nucleotides, which play an important role in various metabolic processes and provide the precursors necessary for the synthesis of RNA and DNA. Cancer cells that exhibit increased cell proliferation also exhibit an increased activity of this encoded protein. Thus, this protein is an attractive target for selective chemotherapy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2013] |
| Protein Pathways | Metabolic pathways, Pyrimidine metabolism |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406236 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC412688 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428462 | CTPS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406236 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 2 |
CNY 3,080.00 |
|
| LY412688 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 1 |
CNY 3,080.00 |
|
| LY428462 | Transient overexpression lysate of CTP synthase II (CTPS2), transcript variant 3 |
CNY 3,080.00 |
|
| PH305993 | CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_062831) |
CNY 19,520.00 |
|
| PH320566 | CTPS2 MS Standard C13 and N15-labeled recombinant protein (NP_787055) |
CNY 19,520.00 |
|
| TP305993 | Recombinant protein of human CTP synthase II (CTPS2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP320566 | Recombinant protein of human CTP synthase II (CTPS2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP326565 | Recombinant protein of human CTP synthase II (CTPS2), transcript variant 3, 20 µg |
CNY 2,900.00 |
