United States
Germany
Japan
United Kingdom
China
PKR (EIF2AK2) (NM_001135651) Human Mass Spec Standard
CAT＃: PH326606
EIF2AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001129123)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 1,999.00
CNY 2,700.00
热销推荐CNY 3,080.00
Specifications
| Product Data | |
| Description | EIF2AK2 MS Standard C13 and N15-labeled recombinant protein (NP_001129123) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226606 |
| Predicted MW | 62.1 kDa |
| Protein Sequence |
>RC226606 protein sequence
Red=Cloning site Green=Tags(s) MAGDLSAGFFMEELNTYRQKQGVVLKYQELPNSGPPHDRRFTFQVIIDGREFPEGEGRSKKEAKNAAAKL AVEILNKEKKAVSPLLLTTTNSSEGLSMGNYIGLINRIAQKKRLTVNYEQCASGVHGPEGFHYKCKMGQK EYSIGTGSTKQEAKQLAAKLAYLQILSEETSVKSDYLSSGSFATTCESQSNSLVTSTLASESSSEGDFSA DTSEINSNSDSLNSSSLLMNGLRNNQRKAKRSLAPRFDLPDMKETKYTVDKRFGMDFKEIELIGSGGFGQ VFKAKHRIDGKTYVIKRVKYNNEKAEREVKALAKLDHVNIVHYNGCWDGFDYDPETSDDSLESSDYDPEN SKNSSRSKTKCLFIQMEFCDKGTLEQWIEKRRGEKLDKVLALELFEQITKGVDYIHSKKLIHRDLKPSNI FLVDTKQVKIGDFGLVTSLKNDGKRTRSKGTLRYMSPEQISSQDYGKEVDLYALGLILAELLHVCDTAFE TSKFFTDLRDGIISDIFDKKEKTLLQKLLSKKPEDRPNTSEILRTLTVWKKSPEKNERHTC myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001129123 |
| RefSeq Size | 4127 |
| RefSeq ORF | 1653 |
| Synonyms | EIF2AK1; LEUDEN; PKR; PPP1R83; PRKR |
| Locus ID | 5610 |
| Cytogenetics | 2p22.2 |
| Summary | The protein encoded by this gene is a serine/threonine protein kinase that is activated by autophosphorylation after binding to dsRNA. The activated form of the encoded protein can phosphorylate translation initiation factor EIF2S1, which in turn inhibits protein synthesis. This protein is also activated by manganese ions and heparin. Three transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Protein Kinase, Transcription Factors |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC400976 | EIF2AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427650 | EIF2AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC427651 | EIF2AK2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY400976 | Transient overexpression lysate of eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 1 |
CNY 3,080.00 |
|
| LY427650 | Transient overexpression lysate of eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 2 |
CNY 3,080.00 |
|
| LY427651 | Transient overexpression lysate of eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 3 |
CNY 3,080.00 |
|
| TP326606 | Purified recombinant protein of Homo sapiens eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP761991 | Purified recombinant protein of Human eukaryotic translation initiation factor 2-alpha kinase 2 (EIF2AK2), transcript variant 2,Glu51-Asn191, with N-terminal His-ABP tag, expressed in E. coli, 50ug |
CNY 2,050.00 |
