United States
Germany
Japan
United Kingdom
China
NCOA4 (NM_001145262) Human Mass Spec Standard
CAT＃: PH326691
NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_001138734)
View other "NCOA4" proteins (10)
|
Need it in bulk or customized? Get a free quote |
CNY 14,250.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_001138734) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226691 |
| Predicted MW | 69.7 kDa |
| Protein Sequence |
>RC226691 protein sequence
Red=Cloning site Green=Tags(s) MNTFQDQSGSSSNREPLLRCSDARRDLELAIGGVLRAEQQIKDNLREVKAQIHSCISRHLECLRSREVWL YEQVDLIYQLKEETLQQQAQQLYSLLGQFNCLTHQLECTQNKDLANQVSVCLERLGSLTLKPEDSTVLLF EADTITLRQTITTFGSLKTIQIPEHLMAHASSANIGPFLEKRGCISMPEQKSASGIVAVPFSEWLLGSKP ASGYQAPYIPSTDPQDWLTQKQTLENSQTSSRACNFFNNVGGNLKGLENWLLKSEKSSYQKCNSHSTTSS FSIEMEKVGDQELPDQDEMDLSDWLVTPQESHKLRKPENGSRETSEKFKLLFQSYNVNDWLVKTDSCTNC QGNQPKGVEIENLGNLKCLNDHLEAKKPLSTPSMVTEDWLVQNHQDPCKVEEVCRANEPCTSFAECVCDE NCEKEALYKWLLKKEGKDKNGMPVEPKPEPEKHKDSLNMWLCPRKEVIEQTKAPKAMTPSRIADSFQVIK NSPLSEWLIRPPYKEGSPKEVPGTEDRAGKQKFKSPMNTSWCSFNTADWVLPGKKMGNLSQLSSGEDKWL LRKKAQEVLLNSPLQEEHNFPPDHYGLPAVCDLFACMQLKVDKEKWLYRTPLQM myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138734 |
| RefSeq Size | 3588 |
| RefSeq ORF | 1842 |
| Synonyms | ARA70; ELE1; PTC3; RFG |
| Locus ID | 8031 |
| Cytogenetics | 10q11.22 |
| Summary | This gene encodes an androgen receptor coactivator. The encoded protein interacts with the androgen receptor in a ligand-dependent manner to enhance its transcriptional activity. Chromosomal translocations between this gene and the ret tyrosine kinase gene, also located on chromosome 10, have been associated with papillary thyroid carcinoma. Alternatively spliced transcript variants have been described. Pseudogenes are present on chromosomes 4, 5, 10, and 14. [provided by RefSeq, Feb 2009] |
| Protein Families | Druggable Genome, Transcription Factors |
| Protein Pathways | Pathways in cancer, Thyroid cancer |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC401665 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428770 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428771 | NCOA4 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY401665 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 5 |
CNY 3,080.00 |
|
| LY428770 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 3 |
CNY 3,080.00 |
|
| LY428771 | Transient overexpression lysate of nuclear receptor coactivator 4 (NCOA4), transcript variant 4 |
CNY 3,080.00 |
|
| PH301606 | NCOA4 MS Standard C13 and N15-labeled recombinant protein (NP_005428) |
CNY 19,520.00 |
|
| TP301606 | Recombinant protein of human nuclear receptor coactivator 4 (NCOA4), transcript variant 5, 20 µg |
CNY 2,900.00 |
|
| TP326691 | Purified recombinant protein of Homo sapiens nuclear receptor coactivator 4 (NCOA4), transcript variant 3, 20 µg |
CNY 2,900.00 |
|
| TP762383 | Purified recombinant protein of Human nuclear receptor coactivator 4 (NCOA4), transcript variant 1, Ser280-Ala553, with N-terminal His tag, expressed in E.coli, 50ug |
CNY 1,950.00 |
