United States
Germany
Japan
United Kingdom
China
GAS2 (NM_001143830) Human Mass Spec Standard
CAT＃: PH326863
GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137302)
View other "GAS2" proteins (11)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
Specifications
| Product Data | |
| Description | GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_001137302) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC226863 |
| Predicted MW | 34.9 kDa |
| Protein Sequence |
>RC226863 protein sequence
Red=Cloning site Green=Tags(s) MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQL AETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFARDNTANFLSWCRDLGVDETCLFESEGLVLHK QPREVCLCLLELGRIAARYGVEPPGLIKLEKEIEQEETLSAPSPSPSPSSKSSGKKSTGNLLDDAVKRIS EDPPCKCPNKFCVERLSQGRYRVGEKILFIRMLHNKHVMVRVGGGWETFAGYLLKHDPCRMLQISRVDGK TSPIQSKSPTLKDMNPDNYLVVSASYKAKKEIK myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001137302 |
| RefSeq Size | 2240 |
| RefSeq ORF | 939 |
| Synonyms | GAS-2 |
| Locus ID | 2620 |
| Cytogenetics | 11p14.3 |
| Summary | The protein encoded by this gene is a caspase-3 substrate that plays a role in regulating microfilament and cell shape changes during apoptosis. It can also modulate cell susceptibility to p53-dependent apoptosis by inhibiting calpain activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2017] |
| Protein Families | Druggable Genome |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC406084 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC417420 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428373 | GAS2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY406084 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 2 |
CNY 3,080.00 |
|
| LY417420 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 1 |
CNY 3,080.00 |
|
| LY428373 | Transient overexpression lysate of growth arrest-specific 2 (GAS2), transcript variant 3 |
CNY 3,080.00 |
|
| PH305912 | GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_808221) |
CNY 19,520.00 |
|
| PH323624 | GAS2 MS Standard C13 and N15-labeled recombinant protein (NP_005247) |
CNY 19,520.00 |
|
| TP305912 | Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP323624 | Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP326863 | Recombinant protein of human growth arrest-specific 2 (GAS2), transcript variant 3, 20 µg |
CNY 2,900.00 |
