United States
Germany
Japan
United Kingdom
China
NEK6 (NM_001145001) Human Mass Spec Standard
CAT＃: PH327083
NEK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138473)
View other "NEK6" proteins (16)
|
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Product images
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
| Product Data | |
| Description | NEK6 MS Standard C13 and N15-labeled recombinant protein (NP_001138473) |
| Species | Human |
| Expression Host | HEK293 |
| Expression cDNA Clone or AA Sequence | RC227083 |
| Predicted MW | 39.7 kDa |
| Protein Sequence |
>RC227083 representing NM_001145001
Red=Cloning site Green=Tags(s) MPRREVCWEAAHFRQEEQSLPRPRVRALVRLACRMAGQPGHMPHGGSSNNLCHTLGPVHPPDPQRHPNTL SFRCSLADFQIEKKIGRGQFSEVYKATCLLDRKTVALKKVQIFEMMDAKARQDCVKEIGLLKQLNHPNII KYLDSFIEDNELNIVLELADAGDLSQMIKYFKKQKRLIPERTVWKYFVQLCSAVEHMHSRRVMHRDIKPA NVFITATGVVKLGDLGLGRFFSSETTAAHSLVGTPYYMSPERIHENGYNFKSDIWSLGCLLYEMAALQSP FYGDKMNLFSLCQKIEQCDYPPLPGEHYSEKLRELVSMCICPDPHQRPDIGYVHQVAKQMHIWMSST myc-FLAG tag |
| Tag | C-Myc/DDK |
| Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Concentration | >0.05 µg/µL as determined by microplate BCA method |
| Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
| Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
| Reference Data | |
| RefSeq | NP_001138473 |
| RefSeq ORF | 1041 |
| Synonyms | SID6-1512 |
| Locus ID | 10783 |
| Cytogenetics | 9q33.3 |
| Summary | The protein encoded by this gene is a kinase required for progression through the metaphase portion of mitosis. Inhibition of the encoded protein can lead to apoptosis. This protein also can enhance tumorigenesis by suppressing tumor cell senescence. Several transcript variants encoding a few different isoforms have been found for this gene. [provided by RefSeq, Oct 2011] |
| Protein Families | Druggable Genome, Protein Kinase |
Documents
| FAQs |
| SDS |
Resources
| 蛋白相关资源 |
Other Versions
| SKU | Description | Size | Price |
|---|---|---|---|
| LC402327 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC428635 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431292 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431305 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431846 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LC431847 | NEK6 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
| LY402327 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2 |
CNY 3,080.00 |
|
| LY428635 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 1 |
CNY 3,080.00 |
|
| LY431292 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 3 |
CNY 3,080.00 |
|
| LY431305 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 7 |
CNY 3,080.00 |
|
| LY431846 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 5 |
CNY 3,080.00 |
|
| LY431847 | Transient overexpression lysate of NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 6 |
CNY 3,080.00 |
|
| PH303609 | NEK6 MS Standard C13 and N15-labeled recombinant protein (NP_055212) |
CNY 19,520.00 |
|
| TP303609 | Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
| TP327083 | Recombinant protein of human NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
| TP328818 | Purified recombinant protein of Homo sapiens NIMA (never in mitosis gene a)-related kinase 6 (NEK6), transcript variant 5, 20 µg |
CNY 2,900.00 |
