Epoxide hydrolase (EPHX1) (NM_001136018) Human Mass Spec Standard
CAT#: PH327627
EPHX1 MS Standard C13 and N15-labeled recombinant protein (NP_001129490)
View other "Epoxide hydrolase" proteins (7)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
CNY 1,999.00
CNY 2,700.00
CNY 3,080.00
Specifications
Product Data | |
Description | EPHX1 MS Standard C13 and N15-labeled recombinant protein (NP_001129490) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227627 |
Predicted MW | 52.9 kDa |
Protein Sequence |
>RC227627 protein sequence
Red=Cloning site Green=Tags(s) MWLEILLTSVLGFAIYWFISRDKEETLPLEDGWWGPGTRSAAREDDSIRPFKVETSDEEIHDLHQRIDKF RFTPPLEDSCFHYGFNSNYLKKVISYWRNEFDWKKQVEILNRYPHFKTKIEGLDIHFIHVKPPQLPAGHT PKPLLMVHGWPGSFYEFYKIIPLLTDPKNHGLSDEHVFEVICPSIPGYGFSEASSKKGFNSVATARIFYK LMLRLGFQEFYIQGGDWGSLICTNMAQLVPSHVKGLHLNMALVLSNFSTLTLLLGQRFGRFLGLTERDVE LLYPVKEKVFYSLMRESGYMHIQCTKPDTVGSALNDSPVGLAAYILEKFSTWTNTEFRYLEDGGLERKFS LDDLLTNVMLYWTTGTIISSQRFYKENLGQGWMTQKHERMKVYVPTGFSAFPFELLHTPEKWVRFKYPKL ISYSYMVRGGHFAAFEEPELLAQDIRKFLSVLERQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001129490 |
RefSeq Size | 1699 |
RefSeq ORF | 1365 |
Synonyms | EPHX; EPOX; HYL1; MEH |
Locus ID | 2052 |
Cytogenetics | 1q42.12 |
Summary | Epoxide hydrolase is a critical biotransformation enzyme that converts epoxides from the degradation of aromatic compounds to trans-dihydrodiols which can be conjugated and excreted from the body. Epoxide hydrolase functions in both the activation and detoxification of epoxides. Mutations in this gene cause preeclampsia, epoxide hydrolase deficiency or increased epoxide hydrolase activity. Alternatively spliced transcript variants encoding the same protein have been found for this gene.[provided by RefSeq, Dec 2008] |
Protein Families | Druggable Genome, Protease |
Protein Pathways | Metabolism of xenobiotics by cytochrome P450 |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC400042 | EPHX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427767 | EPHX1 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY400042 | Transient overexpression lysate of epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 1 |
CNY 3,080.00 |
|
LY427767 | Transient overexpression lysate of epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 2 |
CNY 3,080.00 |
|
PH300621 | EPHX1 MS Standard C13 and N15-labeled recombinant protein (NP_000111) |
CNY 19,520.00 |
|
TP300621 | Recombinant protein of human epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327627 | Recombinant protein of human epoxide hydrolase 1, microsomal (xenobiotic) (EPHX1), transcript variant 2, 20 µg |
CNY 2,900.00 |
其它Epoxide hydrolase产品