TCF3 / E2A (TCF3) (NM_001136139) Human Mass Spec Standard
CAT#: PH327647
TCF3 MS Standard C13 and N15-labeled recombinant protein (NP_001129611)
View other "TCF3 / E2A" proteins (8)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | TCF3 MS Standard C13 and N15-labeled recombinant protein (NP_001129611) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227647 |
Predicted MW | 67.1 kDa |
Protein Sequence |
>RC227647 representing NM_001136139
Red=Cloning site Green=Tags(s) MNQPQRMAPVGTDKELSDLLDFSMMFPLPVTNGKGRPASLAGAQFGGSGLEDRPSSGSWGSGDQSSSSFD PSRTFSEGTHFTESHSSLSSSTFLGPGLGGKSGERGAYASFGRDAGVGGLTQAGFLSGELALNSPGPLSP SGMKGTSQYYPSYSGSSRRRAADGSLDTQPKKVRKVPPGLPSSVYPPSSGEDYGRDATAYPSAKTPSSTY PAPFYVADGSLHPSAELWSPPGQAGFGPMLGGGSSPLPLPPGSGPVGSSGSSSTFGGLHQHERMGYQLHG AEVNGGLPSASSFSSAPGATYGGVSSHTPPVSGADSLLGSRGTTAGSSGDALGKALASIYSPDHSSNNFS SSPSTPVGSPQGLAGTSQWPRAGAPGALSPSYDGGLHGLQSKIEDHLDEAIHVLRSHAVGTAGDMHTLLP GHGALASGFTGPMSLGGRHAGLVGGSHPEDGLAGSTSLMHNHAALPSQPGTLPDLSRPPDSYSGLGRAGA TAAASEIKREEKEDEENTSAADHSEEEKKELKAPRARTSSTDEVLSLEEKDLRDRERRMANNARERVRVR DINEAFRELGRMCQMHLKSDKAQTKLLILQQAVQVILGLEQQVRERNLNPKAACLKRREEEKVSGVVGDP QMVLSAPHPGLSEAHNPAGHM myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001129611 |
RefSeq ORF | 1953 |
Synonyms | AGM8; bHLHb21; E2A; E47; ITF1; p75; TCF-3; VDIR |
Locus ID | 6929 |
Cytogenetics | 19p13.3 |
Summary | This gene encodes a member of the E protein (class I) family of helix-loop-helix transcription factors. E proteins activate transcription by binding to regulatory E-box sequences on target genes as heterodimers or homodimers, and are inhibited by heterodimerization with inhibitor of DNA-binding (class IV) helix-loop-helix proteins. E proteins play a critical role in lymphopoiesis, and the encoded protein is required for B and T lymphocyte development. Deletion of this gene or diminished activity of the encoded protein may play a role in lymphoid malignancies. This gene is also involved in several chromosomal translocations that are associated with lymphoid malignancies including pre-B-cell acute lymphoblastic leukemia (t(1;19), with PBX1), childhood leukemia (t(19;19), with TFPT) and acute leukemia (t(12;19), with ZNF384). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Sep 2011] |
Protein Families | Druggable Genome, ES Cell Differentiation/IPS, Induced pluripotent stem cells, Transcription Factors |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC401107 | TCF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 1,470.00 |
|
LC427823 | TCF3 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY401107 | Transient overexpression lysate of transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) (TCF3), transcript variant 1 |
CNY 4,840.00 |
|
LY427823 | Transient overexpression lysate of transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) (TCF3), transcript variant 2 |
CNY 3,080.00 |
|
PH315432 | TCF3 MS Standard C13 and N15-labeled recombinant protein (NP_003191) |
CNY 19,520.00 |
|
TP315432 | Recombinant protein of human transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) (TCF3), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP327647 | Recombinant protein of human transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) (TCF3), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP760656 | Purified recombinant protein of Human transcription factor 3 (E2A immunoglobulin enhancer binding factors E12/E47) (TCF3), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug |
CNY 2,040.00 |
其它TCF3 / E2A产品