RIZ1 (PRDM2) (NM_001135610) Human Mass Spec Standard
CAT#: PH327715
PRDM2 MS Standard C13 and N15-labeled recombinant protein (NP_001129082)
View other "RIZ1" proteins (3)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | PRDM2 MS Standard C13 and N15-labeled recombinant protein (NP_001129082) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227715 |
Predicted MW | 25.3 kDa |
Protein Sequence |
>RC227715 representing NM_001135610
Red=Cloning site Green=Tags(s) MNQNTTEPVAATETLAEVPEHVLRGLPEEVRLFPSAVDKTRIGVWATKPILKGKKFGPFVGDKKKRSQVK NNVYMWEVYYPNLGWMCIDATDPEKGNWLRYVNWACSGEEQNLFPLEINRAIYYKTLKPIAPGEELLVWY NGEDNPEIAAAIEEERASARSKRSSPKSRKATASAWRPDALHQRPRTSPGSIGRSKLQLQPSSRDHSSKS RHSGCSLTAPEVTWNQ myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001129082 |
RefSeq ORF | 678 |
Synonyms | HUMHOXY1; KMT8; KMT8A; MTB-ZF; RIZ; RIZ1; RIZ2 |
Locus ID | 7799 |
Cytogenetics | 1p36.21 |
Summary | This tumor suppressor gene is a member of a nuclear histone/protein methyltransferase superfamily. It encodes a zinc finger protein that can bind to retinoblastoma protein, estrogen receptor, and the TPA-responsive element (MTE) of the heme-oxygenase-1 gene. Although the functions of this protein have not been fully characterized, it may (1) play a role in transcriptional regulation during neuronal differentiation and pathogenesis of retinoblastoma, (2) act as a transcriptional activator of the heme-oxygenase-1 gene, and (3) be a specific effector of estrogen action. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC427635 | PRDM2 HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY427635 | Transient overexpression lysate of PR domain containing 2, with ZNF domain (PRDM2), transcript variant 4 |
CNY 3,080.00 |
|
TP327715 | Recombinant protein of human PR domain containing 2, with ZNF domain (PRDM2), transcript variant 4, 20 µg |
CNY 2,900.00 |