SKIP (INPP5K) (NM_001135642) Human Mass Spec Standard
CAT#: PH327852
INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_001129114)
View other "SKIP" proteins (11)
Need it in bulk or customized? Get a free quote |
CNY 19,520.00
Specifications
Product Data | |
Description | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_001129114) |
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | RC227852 |
Predicted MW | 51.1 kDa |
Protein Sequence |
>RC227852 protein sequence
Red=Cloning site Green=Tags(s) MSSRKLSGPKGRRLSIHVVTWNVASAAPPLDLSDLLQLNNRNLNLDIYVIGLQELNSGIISLLSDAAFND SWSSFLMDVLSPLSFIKVSHVRMQGILLLVFAKYQHLPYIQILSTKSTPTGLFGYWGNKGGVNICLKLYG YYVSIINCHLPPHISNNYQRLEHFDRILEMQNCEGRDIPNILDHDLIIWFGDMNFRIEDFGLHFVRESIK NRCYGGLWEKDQLSIAKKHDPLLREFQEGRLLFPPTYKFDRNSNDYDTSEKKRKPAWTDRILWRLKRQPC AGPDTPIPPASHFSLSLRGYSSHMTYGISDHKPVSGTFDLELKPLVSAPLIVLMPEDLWTVENDMMVSYS STSDFPSSPWDWIGLYKVGLRDVNDYVSYAWVGDSKVSCSDNLNQVYIDISNIPTTEDEFLLCYYSNSLR SVVGISRPFQIPPGSLREDPLGEAQPQI myc-FLAG tag |
Tag | C-Myc/DDK |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Reference Data | |
RefSeq | NP_001129114 |
RefSeq Size | 3391 |
RefSeq ORF | 1347 |
Synonyms | MDCCAID; PPS; SKIP |
Locus ID | 51763 |
Cytogenetics | 17p13.3 |
Summary | This gene encodes a protein with 5-phosphatase activity toward polyphosphate inositol. The protein localizes to the cytosol in regions lacking actin stress fibers. It is thought that this protein may negatively regulate the actin cytoskeleton. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Oct 2008] |
Protein Families | Druggable Genome, Phosphatase |
Protein Pathways | Inositol phosphate metabolism, Insulin signaling pathway, Metabolic pathways, Phosphatidylinositol signaling system |
Documents
FAQs |
SDS |
Resources
蛋白相关资源 |
Other Versions
SKU | Description | Size | Price |
---|---|---|---|
LC402561 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC408929 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LC427643 | INPP5K HEK293T cell transient overexpression lysate (as WB positive control) |
CNY 900.00 |
|
LY402561 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1 |
CNY 3,080.00 |
|
LY408929 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2 |
CNY 3,080.00 |
|
LY427643 | Transient overexpression lysate of inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3 |
CNY 3,080.00 |
|
PH300092 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_057616) |
CNY 19,520.00 |
|
PH312090 | INPP5K MS Standard C13 and N15-labeled recombinant protein (NP_570122) |
CNY 19,520.00 |
|
TP300092 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 1, 20 µg |
CNY 2,900.00 |
|
TP312090 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 2, 20 µg |
CNY 2,900.00 |
|
TP327852 | Recombinant protein of human inositol polyphosphate-5-phosphatase K (INPP5K), transcript variant 3, 20 µg |
CNY 2,900.00 |