United States
Germany
Japan
United Kingdom
China
MRP1 (ABCC1) Mouse Monoclonal Antibody [Clone ID: IU5C1]
CAT＃: TA309560
Mouse Monoclonal MRP1 Antibody (IU5C1)
Need it in bulk or conjugated?
Get a free quote
CNY 5,381.00
| Cited in 1 publication. |
Product images
CNY 4,840.00
CNY 300.00
CNY 1,430.00
Specifications
| Product Data | |
| Clone Name | IU5C1 |
| Applications | ICC/IF, IHC, WB |
| Recommend Dilution | Immunocytochemistry/ Immunofluorescence, Immunohistochemistry-Paraffin: 1:200, Immunohistochemistry: 1:200, Western Blot: 1:250 - 1:500 |
| Reactivity | Human, Mouse |
| Host | Mouse |
| Clonality | Monoclonal |
| Immunogen | A recombinant peptide corresponding to residues 1-33 (N-terminal: SMALRGFCSADGSDPLWDWNVTWNTSNPDFTKCF) of the human protein. [Swiss-Prot# P33527] |
| Formulation | 0.1% Sodium Azide |
| Purification | Ascites |
| Conjugation | Unconjugated |
| Storage Condition | Store at -20°C as received. |
| Gene Name | ATP binding cassette subfamily C member 1 |
| Database Link | |
| Synonyms | ABC29; ABCC; GS-X; MRP; MRP1 |
| Reference Data | |
| Protein Families | Druggable Genome, Transmembrane |
| Protein Pathways | ABC transporters |
Citations (1)
| The use of this Antibodies has been cited in the following citations: |
|---|
|
Chemical inhibitors and stable knock-down of efflux transport leads to reduced glucuronidation of wushanicaritin in UGT1A1-overexpressing HeLa cells: The role of breast cancer resistance protein (BCRP) and multidrug resistance-associated proteins (MRPs) i
,Qin, Z;Hong, X;Yao, Z;Li, S;Wu, B;Krausz, KW;Gonzalez, F;Gao, H;Yao, X;,
Food & Function
,PubMed ID 29318243
[ABCC1]
|
Documents
| Product Manuals |
| FAQs |
| SDS |
Resources
| 抗体相关资料 |
