Kcna1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB: 1:200-1:2000; IHC: 1:100-1:3000
Reactivity	Human, Mouse, Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	GST fusion protein with sequence HRETEGEEQAQLLHV SSPNLASDSDLSRRSSSTISKSEYMEIEEDMNNSIAHYRQANIRTGN CTTADQNCVNKSKLLTDV, corresponding to amino acid residues 416-495 of mouse Kv1.1, (MW: 36 kDa.).Intracellular, C-terminus.
Formulation	Lyophilized. Concentration before lyophilization ~0.8mg/ml (lot dependent, please refer to CoA along with shipment for actual concentration). Buffer before lyophilization: phosphate buffered saline (PBS), pH 7.4, 1% BSA, 0.05% NaN3.
Reconstitution Method	Add 50 ul double distilled water (DDW) to the lyophilized powder.
Purification	The serum was depleted of anti-GST antibodies by affinity chromatography on immobilized GST and from antibodies cross-reactive to Kv1.2 by affinity chromatography on immobilized KV1.2-GST-fusion protein, and then the antibody was affinity purified on immo
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Gene Name	potassium voltage-gated channel, shaker-related subfamily, member 1
Database Link	NP_034725 Entrez Gene 3736 HumanEntrez Gene 24520 RatEntrez Gene 16485 Mouse UniProt ID P16388
Background	KV1.1 is a mammalian voltage dependent K+ channel, homologous to the Drosophila Shaker K+ channel. KV1.1 was the first mammalian KV channel to be cloned from mouse brain.1 Eight Shaker related genes exist in mammals constituting the KV1, subfamily of the large KV channel family of genes. A functional KV1 channel is either a membrane spanning homotetramer or heterotetramer, which is composed of members of the same subfamily. In addition several auxiliary subunits and intracellular proteins might interact with the channel and affect its function.The structure of KV1.1 channel is similar to all KV channels and includes six membrane spanning helixes creating a voltage sensor domain and a pore domain. The channel is expressed in neurons and cardiac and skeletal muscle tissue as well as in retina and pancreas.2 The functional channel is considered low voltage activated and shows very little inactivation. Therefore, this channel activity influences the membrane potential and excitability of neurons and muscle. Mutations in the coding of KV1.1 gene were discovered in Episodic Ataxia patients.
Synonyms	AEMK; EA1; HBK1; HUK1; HUKI; Kv1.1; MBK1; MGC126782; MGC138385; MK1; RBK1
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.