PTF1A Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PTF1A antibody: synthetic peptide directed towards the N terminal of human PTF1A. Synthetic peptide located within the following region: MDAVLLEHFPGGLDAFPSSYFDEDDFFTDQSSRDPLEDGDELLADEQAEV
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	35 kDa
Gene Name	pancreas specific transcription factor, 1a
Database Link	NP_835455 Entrez Gene 256297 Human UniProt ID Q7RTS3
Background	PTF1A is a pancreas specific transcription factor. Mammalian studies have implicated important roles for the basic helix-loop-helix transcription factor PTF1A-p48 in the development of both exocrine and endocrine pancreas.
Synonyms	bHLHa29; PACA; PAGEN2; PTF1-p48
Note	Immunogen sequence homology: Human: 100%; Pig: 93%; Rat: 93%; Bovine: 93%; Mouse: 92%; Zebrafish: 86%; Dog: 85%; Horse: 77%
Reference Data
Protein Families	Embryonic stem cells, ES Cell Differentiation/IPS

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.