Granzyme H (GZMH) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	IHC, WB
Recommend Dilution	WB, IHC
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-GZMH antibody: synthetic peptide directed towards the N terminal of human GZMH. Synthetic peptide located within the following region: MQPFLLLLAFLLTPGAGTEEIIGGHEAKPHSRPYMAFVQFLQEKSRKRCG
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	27 kDa
Gene Name	granzyme H
Database Link	NP_219491 Entrez Gene 2999 Human UniProt ID P20718
Background	This enzyme is probably necessary for target cell lysis in cell-mediated immune responses.
Synonyms	CCP-X; CGL-2; CSP-C; CTLA1; CTSGL2
Note	Immunogen sequence homology: Human: 100%; Rat: 92%; Mouse: 91%; Horse: 85%
Reference Data
Protein Families	Druggable Genome, Protease

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.