PWWP domain containing protein 2B (PWWP2B) Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-PWWP2B antibody: synthetic peptide directed towards the N terminal of human PWWP2B. Synthetic peptide located within the following region: ILLDCTKKSGLFGLPPLAPLPQVDESPVNDSHGRAPEEGDAEVMQLGSSS
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	53 kDa
Gene Name	PWWP domain containing 2B
Database Link	NP_612508 Entrez Gene 170394 Human UniProt ID Q6NUJ5
Background	The specific function of this protein remains unknown.
Synonyms	bA432J24.1; pp8607; PWWP2
Note	Immunogen sequence homology: Pig: 100%; Human: 100%; Bovine: 100%; Rat: 93%; Mouse: 92%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.