Hps3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Rat
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Hps3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: LSRQRCTFSTLGRVLRMAYSEAGDYLVAIEEKNKTVFLRAYVNWRSKRND
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	113 kDa
Gene Name	Hermansky-Pudlak syndrome 3
Database Link	NP_001101134 Entrez Gene 310288 Rat
Background	The function of Hps3 remains unknown.
Synonyms	DKFZp686F0413; FLJ22704; SUTAL
Note	Immunogen sequence homology: Pig: 100%; Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Bovine: 100%; Rabbit: 100%; Guinea pig: 100%; Dog: 93%; Zebrafish: 85%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.