Mri1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Mri1 antibody: synthetic peptide directed towards the N terminal of mouse 2410018C20RIK. Synthetic peptide located within the following region: LGQVAAQEAEREGATEETVRERVIRFAEDMLEKDLKDNRSIGDLGARHLL
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	41 kDa
Gene Name	methylthioribose-1-phosphate isomerase 1
Database Link	NP_080699 Entrez Gene 67873 Mouse UniProt ID Q9CQT1
Background	This protein was disclosed by the RIKEN Mouse Gene Encyclopaedia Project, a systematic approach to determining the full coding potential of the mouse genome, involves collection and sequencing of full length complementary DNAs and physical mapping of the corresponding genes to the mouse genome.
Synonyms	M1Pi; MGC3207; MTNA; Ypr118w
Note	Immunogen sequence homology: Mouse: 100%; Pig: 93%; Bovine: 93%; Rat: 86%; Horse: 86%; Human: 86%; Dog: 79%; Rabbit: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.