Bola1 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Mouse
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-Bola1 antibody: synthetic peptide directed towards the n terminal of mouse Bola1. Synthetic peptide located within the following region: MLSARSAQCMVSMATRSCVSRGSAGSAAAGPVEAAIRAKLEQALSPEVLE
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Purification	Affinity Purified
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	14 kDa
Gene Name	bolA-like 1 (E. coli)
Database Link	NP_081251 Entrez Gene 69168 Mouse UniProt ID Q9D8S9
Background	The function of the protein remains unknown.
Synonyms	CGI-143; MGC75015; OTTHUMP00000013911; OTTHUMP00000013912; RP11-196G18.18
Note	Immunogen sequence homology: Rat: 100%; Mouse: 100%; Rabbit: 100%; Human: 79%
Reference Data

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.