NR2E3 Rabbit Polyclonal Antibody
CAT#: TA330222
Rabbit Polyclonal Anti-NR2E3 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for Anti-NR2E3 antibody is: synthetic peptide directed towards the middle region of Human NR2E3. Synthetic peptide located within the following region: ARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPC |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 40 kDa |
Gene Name | nuclear receptor subfamily 2 group E member 3 |
Database Link | |
Background | This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. Nuclear receptors have been shown to regulate pathways involved in embryonic development, as well as in maintenance of proper cell function in adults. Members of this family are characterized by discrete domains that function in DNA and ligand binding. This gene encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. Defects in this gene are a cause of enhanced S cone syndrome. Alternatively spliced transcript variants encoding different isoforms have been identified. |
Synonyms | ESCS; PNR; rd7; RNR; RP37 |
Note | Immunogen sequence homology: Horse: 100%; Human: 100%; Bovine: 100%; Pig: 93%; Rat: 93%; Mouse: 93%; Zebrafish: 93%; Guinea pig: 93% |
Reference Data | |
Protein Families | Druggable Genome, Nuclear Hormone Receptor, Transcription Factors |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |