MMP19 Rabbit Polyclonal Antibody
CAT#: TA330243
Rabbit Polyclonal Anti-MMP19 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 4,628.00
CNY 3,080.00
CNY 300.00
CNY 1,430.00
CNY 2,900.00
CNY 6,650.00
CNY 9,998.00
Specifications
Product Data | |
Applications | IHC, WB |
Recommend Dilution | WB, IHC |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-MMP19 antibody: synthetic peptide directed towards the N terminal of human MMP19. Synthetic peptide located within the following region: ALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWR |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 56 kDa |
Gene Name | matrix metallopeptidase 19 |
Database Link | |
Background | Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling. They are also involved in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The function of MMP-19 has not been determined. This gene corresponding to this protein was previously referred to as MMP18 but has been renamed matrix metalloproteinase 19 (MMP19). Multiple transcript variants encoding distict isoforms have been identified for this gene. |
Synonyms | MMP18; RASI-1 |
Note | Immunogen sequence homology: Dog: 100%; Rat: 100%; Human: 100%; Pig: 93%; Horse: 93%; Bovine: 93%; Rabbit: 93%; Mouse: 86% |
Reference Data | |
Protein Families | Protease, Secreted Protein |
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |