BCL2A1 Rabbit Polyclonal Antibody
CAT#: TA330408
Rabbit Polyclonal Anti-BCL2A1 Antibody
Need it in bulk or conjugated?
Get a free quote
CNY 5,250.00
Cited in 1 publication. |
CNY 3,080.00
CNY 300.00
CNY 1,430.00
Specifications
Product Data | |
Applications | WB |
Recommend Dilution | WB |
Reactivity | Human |
Host | Rabbit |
Clonality | Polyclonal |
Immunogen | The immunogen for anti-BCL2A1 antibody: synthetic peptide directed towards the C terminal of human BCL2A1. Synthetic peptide located within the following region: FIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQY |
Formulation | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers. |
Conjugation | Unconjugated |
Storage Condition | Store at -20°C as received. |
Predicted Protein Size | 20 kDa |
Gene Name | BCL2 related protein A1 |
Database Link | |
Background | BCL2A1s a member of the BCL-2 protein family. The proteins of this family form hetero- or homodimers and act as anti- and pro-apoptotic regulators that are involved in a wide variety of cellular activities such as embryonic development, homeostasis and tumorigenesis. The protein encoded by this gene is able to reduce the release of pro-apoptotic cytochrome c from mitochondria and block caspase activation. This gene is a direct transcription target of NF-kappa B in response to inflammatory mediators, and has been shown to be up-regulated by different extracellular signals, such as granulocyte-macrophage colony-stimulating factor (GM-CSF), CD40, phorbol ester and inflammatory cytokine TNF and IL-1, which suggests a cytoprotective function that is essential for lymphocyte activation as well as cell survival. |
Synonyms | ACC-1; ACC-2; ACC1; ACC2; BCL2L5; BFL1; GRS; HBPA1 |
Note | Immunogen sequence homology: Dog: 90%; Pig: 85%; Rat: 78% |
Reference Data | |
Protein Families | Druggable Genome |
Protein Pathways | Metabolic pathways |
Citations (1)
The use of this Antibodies has been cited in the following citations: |
---|
Differentiation of acute myeloid leukemia (AML) cells with ATRA reduces 18F-FDG uptake and increases sensitivity towards ABT-737-induced apoptosis
,null,
Leukemia Lymphoma
,PubMed ID 33140666
[BCL2A1]
|
Documents
Product Manuals |
FAQs |
SDS |
Resources
抗体相关资料 |