CHRNA3 Rabbit Polyclonal Antibody

Specifications

Product Data
Applications	WB
Recommend Dilution	WB
Reactivity	Human
Host	Rabbit
Clonality	Polyclonal
Immunogen	The immunogen for anti-CHRNA3 antibody: synthetic peptide directed towards the N terminal of human CHRNA3. Synthetic peptide located within the following region: QEERLLADLMQNYDPNLRPAERDSDVVNVSLKLTLTNLISLNEREEALTT
Formulation	Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. Note that this product is shipped as lyophilized powder to China customers.
Conjugation	Unconjugated
Storage Condition	Store at -20°C as received.
Predicted Protein Size	57 kDa
Gene Name	cholinergic receptor nicotinic alpha 3 subunit
Database Link	NP_000734 Entrez Gene 1136 Human UniProt ID P32297
Background	The CHRNA3 subunit is expressed in the soma of the majority of pyramidal cells, with the most alpha 3 immunoreactivity observed in CA2-4 and entorhinal cortex and relatively less in CA1 and subicular pyramidal cell soma.
Synonyms	LNCR2; NACHRA3; PAOD2
Note	Immunogen sequence homology: Dog: 100%; Human: 100%; Rabbit: 100%; Bovine: 92%; Guinea pig: 92%; Mouse: 85%; Rat: 85%
Reference Data
Protein Families	Druggable Genome, Ion Channels: Cys-loop Receptors, Transmembrane

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.